Файловый менеджер - Редактировать - /home/bkunreyz/mail/bcmuslimgolfers.com/info/dovecot.index.cache
Назад
�SO_�SO_ � ,7 ���� � _. s Content-Type: multipart/mixed; boundary="mixed-Cpanel::Email::Object-520943-1599034349-0.0886611453849646" , Date: Wed, 02 Sep 2020 08:12:29 GMT ' To: <info@bcmuslimgolfers.com> �SO_ K From: "cPanel on bcmuslimgolfers.com" <cpanel@bcmuslimgolfers.com> L Message-Id: <1599034349.t4YbaUB8Ebzjey8L@premium56.web-hosting.com> � Subject: =?UTF-8?B?W2JjbXVzbGltZ29sZmVycy5jb21dIEVtYWlsIGNvbmZpZ3VyYXRp?= =?UTF-8?B?b24gc2V0dGluZ3MgZm9yIOKAnGluZm9AYmNtdXNsaW1nb2xmZXJzLmNvbQ==?= =?UTF-8?B?4oCdLg==?= � & 0 From: natalieadam89@gmail.com > - Message-ID: <000000000000acb23605b23e2f0d@google.com> " / Subject: SEO+SMO Proposal . . Date: Thu, 22 Oct 2020 08:24:01 +0000 L 2 Content-Type: text/plain; charset="UTF-8"; format=flowed; delsp=yes % 1 To: info@bcmuslimgolfers.com � �A�_ � ' 0 From: anniehenry1972@gmail.com > - Message-ID: <000000000000aaea5505b783e138@google.com> " / Subject: SEO+SMO Proposal . . Date: Mon, 28 Dec 2020 10:38:58 +0000 L 2 Content-Type: text/plain; charset="UTF-8"; format=flowed; delsp=yes % 1 To: info@bcmuslimgolfers.com � ��_ � 7 From: "BOOM OF SALES" <glrqcm@testanfrage.com> < Message-Id: <20210112010702.6A3117D7D8@smtp.ncm.at> A 4 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Mon, 11 Jan 2021 01:22:50 -0800 + Reply-To: contactardados@gmail.com * To: info@bcm-silvers-families.com T �n�_ � & 0 From: margaretrob21@gmail.com > - Message-ID: <0000000000005082bc05b93af011@google.com> " / Subject: SEO+SMO Proposal . . Date: Tue, 19 Jan 2021 06:27:54 +0000 L 2 Content-Type: text/plain; charset="UTF-8"; format=flowed; delsp=yes % 1 To: info@bcmuslimgolfers.com { |` x 2 From: "BOOM OF SALES" <ojxjs@iduotel.com> A 7 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 10 Feb 2021 01:21:55 -0800 + Reply-To: contactardados@gmail.com To: josh@alpinecpas.com � ~�#` | 4 From: "BOOM OF SALES" <yazcdou@iduotel.com> A 7 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 11 Feb 2021 02:12:19 -0800 + Reply-To: contactardados@gmail.com $ To: playlists@playlists.com � a2%` � : ! From: "BOOM OF SALES" <vymjhaghobc@wujogroup.com> E % Message-Id: <20210226013652.F40235B4363B@mail.wujogroup.com> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . $ Date: Thu, 25 Feb 2021 17:36:54 -0800 + # Reply-To: contactardados@gmail.com " To: info@bcmssystem.com _ G}8` � 8 From: "Grow your business" <dgiexzr@rbcell.com> C Message-Id: <20210301010253.C07B6B19FAD@ss2159.rbcell.com> N D Subject: ***SPAM*** Business Wealth & Health Transformation package . Date: Sun, 28 Feb 2021 17:02:52 -0800 ! Content-Type: text/plain To: info@bcm-tech.com � �L<` 9 - From: Nurudeen Al-Atong <nurudeenal60@gmail.com> Y / Message-ID: <CAAd_MkGb3The8Hby6qFEUH_D=fbEuLQDdV_FSPbqZEB74r8H1Q@mail.gmail.com> 5 X Subject: ***SPAM*** Investment Partnership - . Date: Wed, 3 Mar 2021 13:19:00 +0300 U 1 Content-Type: multipart/alternative; boundary="000000000000b7880a05bc9f2e9b" % 0 To: info@bcmuslimgolfers.com �% �b?` � = From: "BOOM OF SALES" <tyeowwoiesr@guanyitechdg.com> A 3 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Thu, 4 Mar 2021 01:53:25 -0800 + Reply-To: contactardados@gmail.com To: info@bcmssystem.com 3 ��@` � 6 ' From: Sudeep Jain <SudeepJain123@hotmail.com> f , Message-ID: <SG2PR06MB2635F5E360878E289E2B04A8E1699@SG2PR06MB2635.apcprd06.prod.outlook.com> " ( Subject: SEO+SMO Proposal . + Date: Thu, 18 Mar 2021 16:17:50 +0000 w < Content-Type: multipart/alternative; boundary="_000_SG2PR06MB2635F5E360878E289E2B04A8E1699SG2PR06MB2635apcp_" !) q}S` � 1 From: "Thecompanydrs" <scxjp@edudew.com> P @ Subject: ***SPAM*** Two Fast & Proven Ways to Grow my Business - NOW! . Date: Tue, 23 Mar 2021 04:17:24 -0700 ! Content-Type: text/plain 2 Reply-To: acessenossositeabaixo@gmail.com * To: info@bcm-silvers-families.com a i;Z` � 7 From: "BOOM OF SALES" <abuwjxgchhr@edudew.com> A 6 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Tue, 23 Mar 2021 07:14:37 +0100 + Reply-To: contactardados@gmail.com ' To: info@fincacarranzasosa.com � UX\` � 7 . From: Aagney shingh <Aagneyshingh@hotmail.com> f 3 Message-ID: <TYAPR01MB25920E0820FADA758040E675C9749@TYAPR01MB2592.jpnprd01.prod.outlook.com> " / Subject: SEO+SMO Proposal - 2 Date: Thu, 8 Apr 2021 13:52:43 +0000 w G Content-Type: multipart/alternative; boundary="_000_TYAPR01MB25920E0820FADA758040E675C9749TYAPR01MB2592jpnp_" �* � o` � . From: "SUPER LIST" <bnnly@yswnas.com> B Message-Id: <20210410191834.D7BFBF74005F@mail.yswnas.com> P 4 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sat, 10 Apr 2021 21:18:36 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com � �6r` � 3 From: "BOOM OF SALES" <pvwqfua@utapao.com> Q Message-Id: <202104190112.13J1C6pT022057-13J1C6pV022057@mail.utapao.com> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Mon, 19 Apr 2021 03:09:08 +0200 + Reply-To: contactardados@gmail.com - To: itoperations@superstructures.com M g�|` � 6 From: "BOOM OF SALES" <xjidbvabj@cenic.co.kr> = Message-ID: <1618792776207379.0.localhost@localhost> A < Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Mon, 19 Apr 2021 03:08:41 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com � ��|` � 1 From: "BOOM OF SALES" <sfiyl@utapao.com> Q Message-Id: <202104241156.13OBuEj3022950-13OBuEj5022950@mail.utapao.com> A 8 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Sat, 24 Apr 2021 13:53:08 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com � ��` � 2 From: "BOOM OF SALES" <zokjno@dig-hum.de> A 4 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Thu, 6 May 2021 12:39:59 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com B�` � 9 From: "BOOM OF SALES" <zdeoooj@popskateshop.com> A 8 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 26 May 2021 18:34:05 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com Y �` � = From: "BOOM OF SALES" <zjlgettoett@popskateshop.com> A 8 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 26 May 2021 18:34:06 +0200 + Reply-To: contactardados@gmail.com * To: info@bcm-silvers-families.com r ƞ�` � 4 From: "BOOM OF SALES" <voous@jovialgrp.com> O Message-ID: <B93F3AAF-9DE5-40AC-80EC-2E11A3674D3B@globalhomeforce.com> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Mon, 14 Jun 2021 21:58:24 +0200 + Reply-To: contactardados@gmail.com . To: contact@wholeheartedlyforever.com R Return-Path: <voous@jovialgrp.com> Return-path: <voous@jovialgrp.com> 0 ( | � � � 8 ) ���` T . From: "SUPER LIST" <adtmq@acgvip.com> P 4 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 28 May 2021 14:56:27 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com L Return-Path: <adtmq@acgvip.com> Return-path: <adtmq@acgvip.com> 0 ( y � b � $ � ���` � 9 From: "BOOM OF SALES" <alxaszaqkhm@agregat63.ru> B Message-Id: <20210627033500.4B6F6245549@mail.oao.agregat> A ? Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Sun, 27 Jun 2021 05:34:57 +0200 + Reply-To: contactardados@gmail.com To: info@bcmsolar.com \ Return-Path: <alxaszaqkhm@agregat63.ru> Return-path: <alxaszaqkhm@agregat63.ru> 0 ( N � � 7 � ��` T 4 From: "BOOM OF SALES" <fucsxlio@acgvip.com> A 9 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Fri, 28 May 2021 23:10:37 +0200 + Reply-To: contactardados@gmail.com % To: info@bcmuslimgolfers.com R Return-Path: <fucsxlio@acgvip.com> Return-path: <fucsxlio@acgvip.com> 0 ( � � � 7 � nz�` � + - From: Ben Azad <azadben@gmail.com> Y / Message-ID: <CADwNhZO5x7eefDPWGqP-O7Yc0EzE=bLEsDQXQ0Dy56f4hJCrpg@mail.gmail.com> 0 Subject: Test . . Date: Wed, 30 Jun 2021 22:31:37 -0700 U 2 Content-Type: multipart/alternative; boundary="0000000000004e91a305c609296a" % 1 To: info@bcmuslimgolfers.com N Return-Path: <azadben@gmail.com> Return-path: <azadben@gmail.com> � A � Z q H � + - u { H � V Y � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 123 6 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 522 7 NIL NIL NIL NIL) "alternative" ("boundary" "0000000000004e91a305c609296a") NIL NIL NIL �S�` � ݞ�`��`���`ݞ�`ݞ�`ݞ�`��`ݞ�`��`��`��`r*�hݞ�`��`ݞ�`ݞ�`r*�hݞ�`��`ݞ�`ݞ�`r*�h��`ݞ�`��`��`��` ������������������������������������������������������������������������������������������������ flags date.received size.physical imap.bodystructure mime.parts hdr.BCC hdr.CC hdr.CONTENT-TRANSFER-ENCODING hdr.CONTENT-TYPE hdr.DATE hdr.DISPOSITION-NOTIFICATION-TO hdr.FROM hdr.IN-REPLY-TO hdr.LIST-POST hdr.MAIL-FOLLOWUP-TO hdr.MAIL-REPLY-TO hdr.MESSAGE-ID hdr.REFERENCES hdr.REPLY-TO hdr.RETURN-PATH hdr.SENDER hdr.SUBJECT hdr.TO hdr.X-DRAFT-INFO hdr.X-KOLAB-MIME-VERSION hdr.X-KOLAB-TYPE hdr.X-PRIORITY � 9 , From: "BOOM OF SALES" <sqrclyel@meganets.com.br> F 0 Message-Id: <20210630201526.90BCAC136AC@mail.meganets.com.br> A _ Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . / Date: Wed, 30 Jun 2021 22:27:36 +0200 + . Reply-To: contactardados@gmail.com \ Return-Path: <sqrclyel@meganets.com.br> Return-path: <sqrclyel@meganets.com.br> - To: info@bcmssystem.com 0 ( � + � � 7 w ���` � 8 From: "BOOM OF SALES" <lelqzymjsgu@sancopy.org> G Message-ID: <C87DBBD1-5A27-4A33-B315-E9253041D940@sancopy.org> A = Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Tue, 29 Jun 2021 07:55:43 +0200 + Reply-To: contactardados@gmail.com Z Return-Path: <lelqzymjsgu@sancopy.org> Return-path: <lelqzymjsgu@sancopy.org> * To: info@bcm-silvers-families.com 0 ( � � � 8 } a��` � G From: "High Excel Bitcoin Investment" <gddawlajlix@utapao.com> Q Message-Id: <202107071046.167AksnQ027882-167AksnS027882@mail.utapao.com> 0 8 Subject: ***SPAM*** Invest in Bitcoin ! Content-Type: text/plain - Date: Wed, 7 Jul 2021 12:46:56 +0200 2 Reply-To: acessenossositeabaixo@gmail.com X Return-Path: <gddawlajlix@utapao.com> Return-path: <gddawlajlix@utapao.com> - To: itoperations@superstructures.com 0 ( H � 3 ] k W r��` � 4 From: "BOOM OF SALES" <esszsmsd@utapao.com> Q Message-Id: <202107091517.169FHXlr005585-169FHXlt005585@mail.utapao.com> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Fri, 9 Jul 2021 17:19:29 +0200 + Reply-To: contactardados@gmail.com R Return-Path: <esszsmsd@utapao.com> Return-path: <esszsmsd@utapao.com> % To: hank89757@emtpigging.com 0 ( � � � � 7 G �h�` � 6 From: "BOOM de vendas" <onissmp@bbrgcipl.com> ~ 6 Subject: ***SPAM*** Divulgue para =?ISO-8859-1?Q?at=E9?= 200 =?ISO-8859-1?Q?MILH=D5ES?= DE EMAILS - Boom de vendas . Date: Mon, 12 Jul 2021 00:36:28 -0700 + Reply-To: contactardados@gmail.com T Return-Path: <onissmp@bbrgcipl.com> Return-path: <onissmp@bbrgcipl.com> To: info@luxsartech.com 0 ( [ � " Y 7 } �*�` � 8 , From: "BOOM de vendas" <obufwi@bierloga.online> G 0 Message-Id: <20210712073625.43F4511E5CA7@mail.bierloga.online> ~ ] Subject: ***SPAM*** Divulgue para =?ISO-8859-1?Q?at=E9?= 200 =?ISO-8859-1?Q?MILH=D5ES?= DE EMAILS - Boom de vendas . / Date: Mon, 12 Jul 2021 00:36:26 -0700 + . Reply-To: contactardados@gmail.com X Return-Path: <obufwi@bierloga.online> Return-path: <obufwi@bierloga.online> % - To: info@bcmuslimgolfers.com 0 ( * � " Y 7 L �0�` ` 8 From: "BOOM OF SALES" <yfqndoprwkh@abee.com.br> A ? Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 21 Jul 2021 10:01:44 -0700 + Reply-To: contactardados@gmail.com Z Return-Path: <yfqndoprwkh@abee.com.br> Return-path: <yfqndoprwkh@abee.com.br> ( To: mcrichton@yellandsavage.com 0 ( � � � 7 � 'S�` � : From: BOOM OF SALES <poaijmphdu@phoenixtv.com.cn> Z Message-ID: <90bba452-d5c1-49f1-b39d-2430ae164690@phx-cas2.corp.phoenixtv.com.cn> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain . Date: Fri, 30 Jul 2021 01:47:19 -0700 - Reply-To: <contactardados@gmail.com> b Return-Path: <poaijmphdu@phoenixtv.com.cn> Return-path: <poaijmphdu@phoenixtv.com.cn> & To: <info@gruporehabitat.com> 0 ( H S � � 7 � ��a � 7 From: "BOOM OF SALES" <htpfmez@gtalarm.com.cn> E Message-Id: <20210801234109.4D4CFA13E9C@mail.gtalarm.com.cn> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Sun, 1 Aug 2021 19:04:51 -0700 + Reply-To: contactardados@gmail.com X Return-Path: <htpfmez@gtalarm.com.cn> Return-path: <htpfmez@gtalarm.com.cn> $ To: info@gruporehabitat.com 0 ( H � � � 7 � ��a � 9 From: BOOM OF SALES <kyqysdfsu@phoenixtv.com.cn> Z Message-ID: <a5872175-1146-4aab-a364-73393fb7d730@phx-cas2.corp.phoenixtv.com.cn> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Tue, 3 Aug 2021 02:11:42 -0700 - Reply-To: <contactardados@gmail.com> ` Return-Path: <kyqysdfsu@phoenixtv.com.cn> Return-path: <kyqysdfsu@phoenixtv.com.cn> & To: <info@gruporehabitat.com> 0 ( H P � � 7 � � a � 6 ! From: "BOOM OF SALES" <bbnonp@ctimyanmar.com> D % Message-Id: <20210804203150.7A5A7E234F@mail.ctimyanmar.com> A C Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - $ Date: Wed, 4 Aug 2021 13:31:51 -0700 + # Reply-To: contactardados@gmail.com V Return-Path: <bbnonp@ctimyanmar.com> Return-path: <bbnonp@ctimyanmar.com> ( " To: healthfitnessnobs@gmail.com 0 ( � , � � 7 � � a L 3 From: "BOOM OF SALES" <wgunaxap@gmail.com> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Fri, 6 Aug 2021 10:04:19 -0700 + Reply-To: contactardados@gmail.com P Return-Path: <wgunaxap@gmail.com> Return-path: <wgunaxap@gmail.com> $ To: info@gruporehabitat.com 0 ( � � � � 7 \ 9� a � 2 From: BOOM OF SALES <lbgby@talcogold.com> O Message-ID: <c2bf7680-9728-4419-b782-80aac26f4e97@srvex.talco-gold.ad> A > Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain . Date: Thu, 12 Aug 2021 12:17:34 -0700 - Reply-To: <contactardados@gmail.com> R Return-Path: <lbgby@talcogold.com> Return-path: <lbgby@talcogold.com> * To: <healthfitnessnobs@gmail.com> 0 ( H � � � � 7 f ta 8 From: "Jamaica Ideal Tours" <hnlnvz@mof.gov.la> > 2 Message-Id: <20210813125327.90DEE102967E9@mof.gov.la> ? Subject: =?utf-8?Q?Spam?= Multi-Lingual Tour Services Content-Type: text/html . Date: Fri, 13 Aug 2021 05:51:56 -0700 - Reply-To: info@jamaicaidealtours.com N Return-Path: <hnlnvz@mof.gov.la> Return-path: <hnlnvz@mof.gov.la> % To: info@bcmuslimgolfers.com ( H � N 9 K "text" "html" ("charset" "us-ascii") NIL NIL "7bit" 2126 57 NIL NIL NIL NIL � xka � 3 ! From: "BOOM OF SALES" <kykazen@ysy.com.cn> B % Message-Id: <20210811061029.61615B0C395E@mail.ysy.com.cn> A H Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . $ Date: Tue, 10 Aug 2021 23:38:11 -0700 + # Reply-To: contactardados@gmail.com P Return-Path: <kykazen@ysy.com.cn> Return-path: <kykazen@ysy.com.cn> $ " To: info@gruporehabitat.com 0 ( W � � 7 � r�a � 2 ! From: "vestblueloan" <eqrlonc@ysy.com.cn> B & Message-Id: <20210813122419.4857CB71846E@mail.ysy.com.cn> 3 @ Subject: ***SPAM*** Do you need a loan ? ! # Content-Type: text/plain . % Date: Fri, 13 Aug 2021 05:52:05 -0700 ) $ Reply-To: vestblueloan@gmail.com P Return-Path: <eqrlonc@ysy.com.cn> Return-path: <eqrlonc@ysy.com.cn> - " To: itoperations@superstructures.com 0 ( H � ' ~ � d �a � 5 ! From: "BOOM OF SALES" <tscrf@ctimyanmar.com> E % Message-Id: <20210819220333.56655BDA100@mail.ctimyanmar.com> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . $ Date: Thu, 19 Aug 2021 15:03:34 -0700 + # Reply-To: contactardados@gmail.com T Return-Path: <tscrf@ctimyanmar.com> Return-path: <tscrf@ctimyanmar.com> % " To: info@bcmuslimgolfers.com 0 ( � � � � 7 _ m a � = ! From: "Funnelytic Blueprint " <fhmxqhczrr@gmail.com> B & Message-Id: <20210821132335.9CBF6C3F384C@mail.jxthxr.com> \ T Subject: ***SPAM*** FREE - 3 Easy Steps to Make Pocket Commissions in 30 Minutes! ! # Content-Type: text/plain . % Date: Sat, 21 Aug 2021 06:23:37 -0700 2 $ Reply-To: acessenossositeabaixo@gmail.com T Return-Path: <fhmxqhczrr@gmail.com> Return-path: <fhmxqhczrr@gmail.com> - " To: itoperations@superstructures.com 0 ( H i � � . / h �l!a � - From: "Nexus" <rmgrukrwid@gmail.com> Q Message-ID: <GENERATED-WASMISSING-1mHQyG-0005Z5-3E@ns3.hostinglotus.net> @ : Subject: ***SPAM*** Good news for all business owners ! Content-Type: text/plain . Date: Sat, 21 Aug 2021 06:23:36 -0700 # Reply-To: sales@nexust.com T Return-Path: <rmgrukrwid@gmail.com> Return-path: <rmgrukrwid@gmail.com> % To: info@bcmuslimgolfers.com 0 ( H � � � � _ ��#a � : ? From: BOOM OF SALES <hldrs@goldengrove.sa.edu.au> O C Message-ID: <8195e346-e36f-4c53-808b-f54e77b8ae71@VOYAGER.gglps.local> A � Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! E Content-Type: text/plain . B Date: Tue, 24 Aug 2021 02:46:36 -0700 - A Reply-To: <contactardados@gmail.com> b Return-Path: <hldrs@goldengrove.sa.edu.au> Return-path: <hldrs@goldengrove.sa.edu.au> ' @ To: <info@bcmuslimgolfers.com> 0 ( H +' �' � � 7 �, D�$a � 3 ! From: "BOOM OF SALES" <fhelpvu@ysy.com.cn> B % Message-Id: <20210816154850.A4B3DB8C3922@mail.ysy.com.cn> A H Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . $ Date: Mon, 16 Aug 2021 09:16:41 -0700 + # Reply-To: contactardados@gmail.com P Return-Path: <fhelpvu@ysy.com.cn> Return-path: <fhelpvu@ysy.com.cn> $ " To: info@gruporehabitat.com 0 ( U � � 7 � =�$a � 6 From: "BOOM OF SALES" <wapuju@ohshipyeah.com> @ Message-ID: <9E8213EE65044F9485CC176677748989.MAI@home> A N Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 25 Aug 2021 12:28:51 -0700 + Reply-To: contactardados@gmail.com V Return-Path: <wapuju@ohshipyeah.com> Return-path: <wapuju@ohshipyeah.com> ( To: ilendercorp@ilendercorp.com 0 ( & u � � 7 � �&a � 1 From: "BOOM OF SALES" <wfkdf@utapao.com> Q Message-Id: <202108260728.17Q7SBaY015410-17Q7SBaa015410@mail.utapao.com> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 26 Aug 2021 00:28:05 -0700 + Reply-To: contactardados@gmail.com L Return-Path: <wfkdf@utapao.com> Return-path: <wfkdf@utapao.com> + To: info@arkpackagingsolutions.com 0 ( � � � � 7 I �B'a � 6 From: "BOOM OF SALES" <swueuwoabu@utapao.com> Q Message-Id: <202108261056.17QAu3BZ004178-17QAu3Bb004178@mail.utapao.com> A 8 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 26 Aug 2021 03:55:56 -0700 + Reply-To: contactardados@gmail.com V Return-Path: <swueuwoabu@utapao.com> Return-path: <swueuwoabu@utapao.com> % To: info@bcmuslimgolfers.com 0 ( ; t � � 7 � �s'a � 0 From: "SUPER LIST" <vziatbnv@gmail.com> 5 Message-Id:<61281EE0.5ED0B6.04566@jl.gov.cn> P G Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Mon, 23 Aug 2021 12:14:15 -0700 + Reply-To: contactardados@gmail.com P Return-Path: <vziatbnv@gmail.com> Return-path: <vziatbnv@gmail.com> To: info@luxsartech.com 0 ( b � c � % � � (a � 1 From: BOOM OF SALES <ajogws@hotmail.com> Z Message-ID: <aaa612e9-ea62-41aa-afea-77ed3410e603@phx-cas2.corp.phoenixtv.com.cn> A A Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain . Date: Sun, 29 Aug 2021 20:48:30 -0700 - Reply-To: <contactardados@gmail.com> P Return-Path: <ajogws@hotmail.com> Return-path: <ajogws@hotmail.com> ' To: <info@bcmuslimgolfers.com> 0 ( H � � � � 7 0 hU,a � . From: "SUPER LIST" <mobsgz@gmail.com> 5 Message-Id:<612C8BA4.55B433.03289@bdjsh.com> P H Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sat, 28 Aug 2021 17:57:43 -0700 + Reply-To: contactardados@gmail.com L Return-Path: <mobsgz@gmail.com> Return-path: <mobsgz@gmail.com> & To: christinfanelli@gmail.com 0 ( � c � % ڋ,a T 5 From: "BOOM OF SALES" <oqrvfdrp@hotmail.com> A C Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Wed, 1 Sep 2021 22:42:01 -0700 + Reply-To: contactardados@gmail.com T Return-Path: <oqrvfdrp@hotmail.com> Return-path: <oqrvfdrp@hotmail.com> # To: info@cartesiano360.com 0 ( � 3 � � 7 � /d0a T - From: "SUPER LIST" <elwwo@gmail.com> P ? Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Sun, 5 Sep 2021 03:07:57 -0700 + Reply-To: contactardados@gmail.com J Return-Path: <elwwo@gmail.com> Return-path: <elwwo@gmail.com> % To: info@bcmuslimgolfers.com 0 ( � � b � $ � �4a � 0 From: "BOOM OF SALES" <ahmri@gmail.com> A Message-Id: <20210907042136.B7717280801@mail.edu.shd.ru> A N Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Mon, 6 Sep 2021 21:21:37 -0700 + Reply-To: contactardados@gmail.com J Return-Path: <ahmri@gmail.com> Return-path: <ahmri@gmail.com> $ To: info@opt-automation.com 0 ( I � � � 7 � E�6a � 6 From: "Enter Products" <postmaster@ugazy.com> G Message-ID: <14A366722E0C483FAF4B743AD372CBE3.MAI@Dawarly.com> W 3 Subject: ***SPAM*** Design you own Bills, Cups... and find the best products ! Content-Type: text/plain - Date: Wed, 7 Jul 2021 10:34:28 +0200 T Return-Path: <postmaster@ugazy.com> Return-path: <postmaster@ugazy.com> ! To: contact@wyndsoft.com 0 ( H � W f � ��Ja � 5 From: "BOOM OF SALES" <rlkkk@spilrelease.dk> C Message-Id: <20210926095751.84EC31A0CE8@mail.playright.dk> A 9 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Sun, 26 Sep 2021 02:57:52 -0700 + Reply-To: contactardados@gmail.com T Return-Path: <rlkkk@spilrelease.dk> Return-path: <rlkkk@spilrelease.dk> % To: info@bcmuslimgolfers.com 0 ( � % � � 7 � �Pa � 8 From: "BOOM OF SALES" <xkpcub@tomtaylor.online> Q Message-ID: <453ADB4E-5B94-4577-9C83-E35C1D646700@mail.tomtaylor.online> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Thu, 7 Oct 2021 08:26:08 -0700 + Reply-To: contactardados@gmail.com Z Return-Path: <xkpcub@tomtaylor.online> Return-path: <xkpcub@tomtaylor.online> + To: contact@aussiestudyexpress.com 0 ( � 7 � � 8 � [�aa h 6 From: "BOOM OF SALES" <iitztoo@yunshuads.top> N 3 Subject: ***SPAM*** ONLY TODAY - Advertise up to 400 MILLION EMAILS . Date: Fri, 22 Oct 2021 00:56:09 -0700 + Reply-To: contactardados@gmail.com V Return-Path: <iitztoo@yunshuads.top> Return-path: <iitztoo@yunshuads.top> ' To: info@amomentforbalance.com 0 ( J F * 2 �sa \ 4 From: "BOOM OF SALES" <nqvrqcw@hotmail.com> N : Subject: ***SPAM*** ONLY TODAY - Advertise up to 400 MILLION EMAILS . Date: Sun, 24 Oct 2021 17:37:32 -0700 + Reply-To: contactardados@gmail.com R Return-Path: <nqvrqcw@hotmail.com> Return-path: <nqvrqcw@hotmail.com> ! To: info@themenubook.com 0 ( � � F * � iya � 0 From: BOOM OF SALES <ewomqu@osiatis.es> N Message-ID: <84983e4edefb4f888cf6e98bcc20543c@SEMMAD001WF.osiatis.es> A > Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Mon, 1 Nov 2021 00:01:01 -0700 - Reply-To: <contactardados@gmail.com> N Return-Path: <ewomqu@osiatis.es> Return-path: <ewomqu@osiatis.es> " To: <info@bcmssystem.com> 0 ( H � | � 1 T ߐa � + From: SUPER LIST <lmhvm@gmail.com> P Message-ID: <f87b3a8a-15bd-4522-bdc9-2a41a0905a28@EX-SERV.cairo.gov.eg> P H Subject: ***SPAM*** Email lists 100% VALID - Any country in the world ! Content-Type: text/plain - Date: Sat, 6 Nov 2021 00:01:19 +0300 - Reply-To: <contactardados@gmail.com> J Return-Path: <lmhvm@gmail.com> Return-path: <lmhvm@gmail.com> ( To: <contact@shellajewelry.com> 0 ( H � � / M � e��a h 5 From: "SUPER LIST" <nhpmoqjvcsf@hingpay.com> P 4 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Tue, 9 Nov 2021 22:56:53 +0300 + Reply-To: contactardados@gmail.com Z Return-Path: <nhpmoqjvcsf@hingpay.com> Return-path: <nhpmoqjvcsf@hingpay.com> $ To: info@novelaisystems.com 0 ( � � / M � �Ҋa � ) From: SUPER LIST <rxmmf@arsu.kz> N Message-ID: <cebf4af9-ec10-48c5-ae6d-abb89450ee4a@arsu-dc-11.arsu.kz> P 7 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world ! Content-Type: text/plain . Date: Wed, 10 Nov 2021 18:41:30 +0300 - Reply-To: <contactardados@gmail.com> F Return-Path: <rxmmf@arsu.kz> Return-path: <rxmmf@arsu.kz> + To: <comercial_davico@hotmail.com> 0 ( H � � / M � ~�a � - ! From: "SUPER LIST" <nuhua@gmail.com> D % Message-Id: <20211115021202.05B7332CA61@mail.gowakab.go.id> P O Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . $ Date: Mon, 15 Nov 2021 05:11:36 +0300 + # Reply-To: contactardados@gmail.com J Return-Path: <nuhua@gmail.com> Return-path: <nuhua@gmail.com> " To: mail@solptfe.com 0 ( W � / M � ��a � 6 ! From: "SUPER LIST" <rsohmqbtn@plasmacomp.com> F % Message-Id: <20211115191518.84E366510C26@mail.plasmacomp.com> P E Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . $ Date: Mon, 15 Nov 2021 22:14:48 +0300 + # Reply-To: contactardados@gmail.com \ Return-Path: <rsohmqbtn@plasmacomp.com> Return-path: <rsohmqbtn@plasmacomp.com> & " To: websitesaveetha@gmail.com 0 ( � . / M ��a � / From: SUPER LIST <ksvspsjenrb@arsu.kz> N Message-ID: <f1970510-1182-4ef1-a285-edc03718b73a@arsu-dc-11.arsu.kz> P 7 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world ! Content-Type: text/plain . Date: Thu, 18 Nov 2021 15:40:35 +0300 - Reply-To: <contactardados@gmail.com> R Return-Path: <ksvspsjenrb@arsu.kz> Return-path: <ksvspsjenrb@arsu.kz> - To: <info@chemicalnewsreports24.com> 0 ( H � � / M � 0K�a � 1 From: "Tino Ludwig" <hsqjljl@utapao.com> Q Message-Id: <202111181336.1AIDaBX4019578-1AIDaBX6019578@mail.utapao.com> S 6 Subject: ***SPAM*** Jetzt bis zu 100% Steuern sparen, schnell und legal! ! Content-Type: text/plain . Date: Thu, 18 Nov 2021 05:36:13 -0800 % Reply-To: Tino.Ludwig@me.com P Return-Path: <hsqjljl@utapao.com> Return-path: <hsqjljl@utapao.com> To: info@bcmsolar.com 0 ( H � � x � � ~W�a d 1 From: I am Winners <info@iamwinners.com> O Message-ID: <59ZAVaElkMYA95PqPe5bIbE4y1Xk7hIkSgvdm1ink@iamwinners.com> E J Subject: ***SPAM*** Hemos recibido tu mensaje de contacto. ( Content-Transfer-Encoding: 8bit 0 Content-Type: text/plain; charset=UTF-8 - Date: Wed, 8 Dec 2021 10:32:59 +0000 & Reply-To: info@iamwinners.com j Return-Path: <q10sports@host4001.e-andorra.eu> Return-path: <q10sports@host4001.e-andorra.eu> % To: info@bcmuslimgolfers.com ( H F � v � H "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 387 13 NIL NIL NIL NIL � ��a � H # From: Fiora - Education WordPress Theme <support@kevthemes.com> _ & Message-ID: <AnYLFvTOHYCynBMP1CkCDVuHt7ViRxiKHOswnSZ8Ks@stjohnschurchfriernbarnet.org> > % Subject: Fiora - Education WordPress Theme "as4moqgv" ( , Content-Transfer-Encoding: 8bit 0 + Content-Type: text/plain; charset=UTF-8 . ! Date: Wed, 15 Dec 2021 12:59:12 +0000 & $ Reply-To: dgtthemes@gmail.com � Return-Path: <bounce+support=kevthemes.com@b.atomicsites.net> Return-path: <bounce+support=kevthemes.com@b.atomicsites.net> ? Sender: bounce+support=kevthemes.com@b.atomicsites.net % " To: info@bcmuslimgolfers.com ( H � � � � G "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 234 9 NIL NIL NIL NIL s ��a � \ From: =?UTF-8?B?6Iul6ICFVEVDSOODl+ODreOCuOOCp+OCr+ODiA==?= <reply@wakamono-tech.jp> H Message-ID: <15d70d174df6e112673b5e43da67d446@wakamono-tech.jp> � Subject: =?UTF-8?B?44CQ6Iul6ICFVEVDSOODl+ODreOCuOOCp+OCr+ODiOOAkeOBiuWVj+OBhA==?= =?UTF-8?B?5ZCI44KP44Gb44GC44KK44GM44Go44GG44GU44GW44GE44G+44GZ44CC?= ( # Content-Transfer-Encoding: 8bit 0 " Content-Type: text/plain; charset=UTF-8 . Date: Fri, 24 Dec 2021 23:56:19 +0000 X Return-Path: <reply@wakamono-tech.jp> Return-path: <reply@wakamono-tech.jp> % To: info@bcmuslimgolfers.com ( H d � " G % I "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 1095 37 NIL NIL NIL NIL � T^�a � Q From: =?UTF-8?B?5aSp5rqA5aSp56We5qKF6YWS5aSn5Lya?= <ut@umeshutaikai.com> H Message-ID: <bab065edbbfbc6aecd064d817b0c312b@umeshutaikai.com> � Subject: =?UTF-8?B?44CQ5aSp5rqA5aSp56We5qKF6YWS5aSn5Lya44CR44GK5ZWP44GE5ZCI44KP?= =?UTF-8?B?44Gb44GE44Gf44Gg44GN44GC44KK44GM44Go44GG44GU44GW44GE44G+44GX?= =?UTF-8?B?44Gf44CC?= ( # Content-Transfer-Encoding: 8bit 0 " Content-Type: text/plain; charset=UTF-8 . Date: Tue, 28 Dec 2021 13:00:46 +0000 & Reply-To: ut@umeshutaikai.com R Return-Path: <ut@umeshutaikai.com> Return-path: <ut@umeshutaikai.com> % To: info@bcmuslimgolfers.com ( H ( c D [ H "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 859 23 NIL NIL NIL NIL l � �a � ' From: ARIA <info@aria-921.com> D Message-ID: <5dc1d8f938acf9288cccd655218c2095@aria-921.com> } : Subject: ***SPAM*** =?UTF-8?B?44GK5ZWP44GE5ZCI44KP44Gb44KS5Y+X44GR5LuY44GR44G+44GX44Gf44CC?= =?UTF-8?B?QVJJQQ==?= ( Content-Transfer-Encoding: 8bit 0 Content-Type: text/plain; charset=UTF-8 . Date: Wed, 29 Dec 2021 01:14:59 +0000 $ Reply-To: info@aria-921.com j Return-Path: <aria-921@users304.phy.heteml.jp> Return-path: <aria-921@users304.phy.heteml.jp> % To: info@bcmuslimgolfers.com ( H � n � H "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 384 18 NIL NIL NIL NIL Q ö�a < @ From: "THEPLANETARYCLUB.COM" <info@bcmuslimgolfers.com> Y Message-ID: <v4Mb4JcQIIdYkZoICmOyZOFNnWz4LsQh6UC7QSWkk@www.theplanetaryclub.com> ' D Subject: ***SPAM*** dcz61xis ( Content-Transfer-Encoding: 8bit / Content-Type: text/html; charset=utf-8 . Date: Thu, 30 Dec 2021 22:52:29 +0000 r Return-Path: <theplanetaryclub@www110.masbytes.es> Return-path: <theplanetaryclub@www110.masbytes.es> % To: info@bcmuslimgolfers.com ( H < � * G "text" "html" ("charset" "utf-8") NIL NIL "8bit" 810 11 NIL NIL NIL NIL [ _8�a � 3 " From: Gangzai <contact@gangzai-design.com> k $ Message-ID: <0102017e15f625ee-ff964868-80ed-4f3d-beac-03a8069611b6-000000@eu-west-1.amazonses.com> 0 # Subject: GANGZAI Demande de rendez-vous ( ) Content-Transfer-Encoding: 8bit ] ' Content-Type: multipart/alternative; boundary="b1_da233b8b0c57b5c1e8c27a766d5eab5b" - Date: Sat, 1 Jan 2022 14:06:00 +0000 � Return-Path: <0102017e15f625ee-ff964868-80ed-4f3d-beac-03a8069611b6-000000@eu-west-1.amazonses.com> Return-path: <0102017e15f625ee-ff964868-80ed-4f3d-beac-03a8069611b6-000000@eu-west-1.amazonses.com> % ! To: info@bcmuslimgolfers.com � A � D Y | H F I L $ * H � H K � � ("text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 298 6 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "8bit" 782 15 NIL NIL NIL NIL) "alternative" ("boundary" "b1_da233b8b0c57b5c1e8c27a766d5eab5b") NIL NIL NIL K �_�a � \ From: =?ISO-2022-JP?B?GyRCTS04QjJxPFIlKCVgJTo1Ozd6GyhC?= <yu.msgiken@yk.commufa.jp> D Message-ID: <c033f3285d23370fafd1336e7c2dce3b@ms-giken.com> � 7 Subject: ***SPAM*** =?ISO-2022-JP?B?GyRCIVpNLThCMnE8UiUoJWAlOjU7N3obKEIgGyRCIVskKkxkJCQ5ZyRvJDskIiRqJCwkSCQmJDQkNiQkJF4kORsoQg==?= 6 Content-Type: text/plain; charset=ISO-2022-JP - Date: Fri, 7 Jan 2022 13:45:24 +0000 d Return-Path: <anonymous@ae154.secure.ne.jp> Return-path: <anonymous@ae154.secure.ne.jp> % To: info@bcmuslimgolfers.com ( H � > # N "text" "plain" ("charset" "ISO-2022-JP") NIL NIL "7bit" 830 35 NIL NIL NIL NIL � $D�a � 0 From: "Luigui Bleand" <xmifu@gmail.com> @ Message-Id: <20220112123318.BA730E54A0@mail.rockbit.cc> 9 L Subject: ***SPAM*** Do you know Luigui Bleand? ! Content-Type: text/plain . Date: Wed, 12 Jan 2022 04:02:57 -0800 2 Reply-To: acessenossositeabaixo@gmail.com J Return-Path: <xmifu@gmail.com> Return-path: <xmifu@gmail.com> * To: administrador@goldface.com.br 0 ( H � � � ���a ` ; From: "BOOM OF SALES" <postmaster@optimist.biz.ua> A P Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . ! Date: Sat, 15 Jan 2022 05:16:35 +0300 + Reply-To: contactardados@gmail.com ` Return-Path: <postmaster@optimist.biz.ua> Return-path: <postmaster@optimist.biz.ua> To: info@sivanabosc.com 0 ( � O � � 7 � �.�a \ F From: Fredensborg Forsyning <noreply@fredensborgforsyning.dk> ` Message-Id: <afa19dbf.AVUAAETmAI4AAAAAAAAAALKyTRcAAYCrSNoAAAAAAAls8QBh5ShZ@mailjet.com> ] Subject: Din =?UTF-8?Q?ans=C3=B8gning?= om fritagelse for betaling af vandafledning 4 . Content-Transfer-Encoding: quoted-printable > - Content-Type: text/html; charset=UTF-8; format=flowed . ! Date: Mon, 17 Jan 2022 09:27:05 +0100 J Reply-to: Fredensborg Forsyning <noreply@fredensborgforsyning.dk> � Return-Path: <afa19dbf.AVUAAETmAI4AAAAAAAAAALKyTRcAAYCrSNoAAAAAAAls8QBh5ShZ@bnc3.mailjet.com> Return-path: <afa19dbf.AVUAAETmAI4AAAAAAAAAALKyTRcAAYCrSNoAAAAAAAls8QBh5ShZ@bnc3.mailjet.com> % To: info@bcmuslimgolfers.com ( H ( z : j 0 f "text" "html" ("charset" "UTF-8" "format" "flowed") NIL NIL "quoted-printable" 1898 48 NIL NIL NIL NIL b �(�a � / From: Centro COME <info@centrocome.it> ? ! Message-ID: <TVOsZ_k4R4ypGKWznaTzQw@geopod-ismtpd-5-1> ( " Subject: Centro COME - Contatti s Content-Type: multipart/alternative; boundary=e1873fa3e53d2a984e6f0e661bcbbc260009d462eb285c0e067e33bec3ee 4 Date: Mon, 17 Jan 2022 11:05:00 +0000 (UTC) � Return-Path: <bounces+1324161-2021-info=bcmuslimgolfers.com@sendgrid.net> Return-path: <bounces+1324161-2021-info=bcmuslimgolfers.com@sendgrid.net> % + To: info@bcmuslimgolfers.com � A + | � � H j l p � � H � f j X p ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 210 3 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "quoted-printable" 1392 24 NIL NIL NIL NIL) "alternative" ("boundary" "e1873fa3e53d2a984e6f0e661bcbbc260009d462eb285c0e067e33bec3ee") NIL NIL NIL � �M�a � ; From: Autoservice Sibiu <info@bcmuslimgolfers.com> ; Message-Id: <E1nA7k0-005Kuk-5l@core3.hostbase.net> & S Subject: ***SPAM*** 6j3889e / Content-type: text/html; charset=utf-8 . Date: Wed, 19 Jan 2022 11:58:56 +0200 b Return-Path: <autoserv@core3.hostbase.net> Return-path: <autoserv@core3.hostbase.net> % To: info@bcmuslimgolfers.com ( H � � X � ( H "text" "html" ("charset" "utf-8") NIL NIL "7bit" 1152 40 NIL NIL NIL NIL � ��a d 8 From: "BOOM OF SALES" <mnxtezpocu@jsznkjgs.top> A = Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 19 Jan 2022 14:59:30 +0300 + Reply-To: contactardados@gmail.com Z Return-Path: <mnxtezpocu@jsznkjgs.top> Return-path: <mnxtezpocu@jsznkjgs.top> ) To: contact@bistrot-aviation.com 0 ( � � � � 7 M �B�a � / From: "=?UTF-8?B?0JDQstGC0L7RgdC10YDQstC40YHRiyDQqNC80LjQtCAtINCx0YvRgdGC0YDQvg==?= =?UTF-8?B?0LUsINC60L7QvNGE0L7RgNGC0L3QvtC1INGC0LXRhdC+0LHRgdC70YPQttC40LI=?= =?UTF-8?B?0LDQvdC40LUsINCh0KLQniwg0LzQsNCz0LDQt9C40L3RiyDQsNCy0YLQvtC30LA=?= =?UTF-8?B?0L/Rh9Cw0YHRgtC10Lk=?=" <info@schmidac.ru> @ ! Message-Id: <E1nB7d5-0003Xb-37@phoenix.vps-private.net> � E Subject: ***SPAM*** =?UTF-8?B?0JTQtdGC0LDQu9C4INGD0YfRkdGC0L3QvtC5INC30LDQv9C40YHQuCBpbmZvQGI=?= =?UTF-8?B?Y211c2xpbWdvbGZlcnMuY29tINC90LAg0YHQsNC50YLQtSDCq9Co0LzQuNC00LM=?= =?UTF-8?B?0LDRgNCw0LbCuw==?= ( Content-Transfer-Encoding: 8Bit ] Content-Type: multipart/mixed; boundary="0a7b68d319be996e2355a48774ac6e3b44f7005f1" . # Date: Sat, 22 Jan 2022 07:03:55 +0300 h Return-Path: <u10402@phoenix.vps-private.net> Return-path: <u10402@phoenix.vps-private.net> 2 " Sender: <u10402@phoenix.vps-private.net> 5 To: "info_297846" <info@bcmuslimgolfers.com> � A � � ? � A � | � 9 s H � e i | � H � d h k | M (("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 1175 27 NIL ("inline" NIL) NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "8Bit" 2172 17 NIL ("inline" NIL) NIL NIL) "alternative" ("boundary" "cddfeec9cbdbf2219e3e7442415ba5a4bf72f65f0") NIL NIL NIL) "mixed" ("boundary" "0a7b68d319be996e2355a48774ac6e3b44f7005f1") NIL NIL NIL � Z��a � 8 From: "Offshore IBC" <postmaster@apollo-nz.com> I Message-ID: <236D3F752BB241138F4341E53BE8644F.MAI@Apollo-NZ.com> U 7 Subject: ***SPAM*** Virtual office, virtual address and registered address ! Content-Type: text/plain - Date: Sun, 2 Jan 2022 13:45:42 -0800 2 Reply-To: acessenossositeabaixo@gmail.com \ Return-Path: <postmaster@apollo-nz.com> Return-path: <postmaster@apollo-nz.com> To: ahmed@ahmedge.com 0 ( H s � 6 � �B�a � 5 From: BOOM OF SALES <snkgkdnrc@joyfitnes.ru> L Message-ID: <57b81c8d-87c4-4555-9fa3-e60f4bb0834a@JOY-ES.joy.local> A = Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain . Date: Sun, 23 Jan 2022 11:40:03 +0300 - Reply-To: <contactardados@gmail.com> X Return-Path: <snkgkdnrc@joyfitnes.ru> Return-path: <snkgkdnrc@joyfitnes.ru> ' To: <info@bcmuslimgolfers.com> 0 ( H � � � � 7 ; ��a L 2 From: "BOOM OF SALES" <jwbabkwd@jngle.ru> A 3 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Sun, 23 Jan 2022 11:40:04 +0300 + Reply-To: contactardados@gmail.com N Return-Path: <jwbabkwd@jngle.ru> Return-path: <jwbabkwd@jngle.ru> " To: info@byloveevents.com 0 ( W � � � 7 � �a t From: noreply@OMenu.com A Message-ID: <1216be471bee8aa8a481efabbffd65cf@qrmenu.hr> 2 J Subject: ***SPAM*** Verification OME.NU 4 # Content-Transfer-Encoding: quoted-printable / " Content-Type: text/html; charset=utf-8 . Date: Wed, 26 Jan 2022 17:50:01 +0000 � Return-Path: <bounce+53f3d8.ef509a-info=bcmuslimgolfers.com@omenu.com> Return-path: <bounce+53f3d8.ef509a-info=bcmuslimgolfers.com@omenu.com> " Sender: noreply@omenu.com % To: info@bcmuslimgolfers.com ( H � . : H S "text" "html" ("charset" "utf-8") NIL NIL "quoted-printable" 584 14 NIL NIL NIL NIL ��a ` 9 From: "BOOM OF SALES" <yagcgpcir@jakomobile.com> A < Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 27 Jan 2022 14:18:24 +0300 + Reply-To: contactardados@gmail.com \ Return-Path: <yagcgpcir@jakomobile.com> Return-path: <yagcgpcir@jakomobile.com> # To: hello@blackcarseat.com 0 ( � � � 7 ��a < > From: WordPress <udoshigen.recycle-station@gmail.com> Q Message-ID: <J0ahfvFJqE94RODK1KsgYb7fbF8gyigBUWGGb2qJNrE@udo-shigen.com> - @ Subject: ***SPAM*** [your-subject] ( Content-Transfer-Encoding: 8bit 0 Content-Type: text/plain; charset=UTF-8 . Date: Fri, 28 Jan 2022 05:22:39 +0000 r Return-Path: <udoshigen.recycle-station@gmail.com> Return-path: <udoshigen.recycle-station@gmail.com> % To: info@bcmuslimgolfers.com ( H K � � H "text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 691 30 NIL NIL NIL NIL � �}�a P 3 From: "BOOM OF SALES" <nelcwd@visqual.com> A 7 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Tue, 1 Feb 2022 12:07:22 +0300 + Reply-To: contactardados@gmail.com P Return-Path: <nelcwd@visqual.com> Return-path: <nelcwd@visqual.com> & To: book@freemolimophilly.com 0 ( [ � � � 7 Ͻ�a � / From: "Sport Shirts"<maxpo01@sina.com> ? Message-ID: <20220204150805.12197F4697A00938@sina.com> 3 E Subject: ***SPAM*** Sport Wear Quotation ( Content-Transfer-Encoding: 8bit ! Content-Type: text/plain ) Date: 04 Feb 2022 15:08:08 +0800 L Return-Path: <maxpo01@sina.com> Return-path: <maxpo01@sina.com> % To: info@bcmuslimgolfers.com ( H q � A ' L "text" "plain" ("charset" "us-ascii") NIL NIL "8bit" 1345 39 NIL NIL NIL NIL � ��a � _ & From: =?UTF-8?B?2LXZhtin24zYuSDYotiz2KfZhtiz2YjYsSDZhdmE2qnbjA==?= <cs@malekilift.com> N ( Message-ID: <Zn3ZQVVRTimeZC7D7EVHYdFqPtsa9UNmipbeK36I@malekilift.com> N " Subject: =?UTF-8?B?2KrYp9im24zYryDYr9ix24zYp9mB2Kog2LTaqdin24zYqg==?= ( - Content-Transfer-Encoding: 8bit e + Content-Type: multipart/alternative; boundary="b1_Zn3ZQVVRTimeZC7D7EVHYdFqPtsa9UNmipbeK36I" - % Date: Sat, 5 Feb 2022 23:42:37 +0000 $ ' Reply-To: cs@malekilift.com n Return-Path: <malekilift@linux7.jump-server.com> Return-path: <malekilift@linux7.jump-server.com> % ! To: info@bcmuslimgolfers.com � A � � � H I L � H { H K A Z � ("text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 525 14 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "8bit" 1114 25 NIL NIL NIL NIL) "alternative" ("boundary" "b1_Zn3ZQVVRTimeZC7D7EVHYdFqPtsa9UNmipbeK36I") NIL NIL NIL 6 � �a � _ & From: =?UTF-8?B?2LXZhtin24zYuSDYotiz2KfZhtiz2YjYsSDZhdmE2qnbjA==?= <cs@malekilift.com> Q ( Message-ID: <LoHBKnLMn0uOPFBCm2TsG5Moil7f6EYjAWf60a1y5ZM@malekilift.com> N " Subject: =?UTF-8?B?2KrYp9im24zYryDYr9ix24zYp9mB2Kog2LTaqdin24zYqg==?= ( - Content-Transfer-Encoding: 8bit h + Content-Type: multipart/alternative; boundary="b1_LoHBKnLMn0uOPFBCm2TsG5Moil7f6EYjAWf60a1y5ZM" - % Date: Sat, 5 Feb 2022 23:42:40 +0000 $ ' Reply-To: cs@malekilift.com n Return-Path: <malekilift@linux7.jump-server.com> Return-path: <malekilift@linux7.jump-server.com> % ! To: info@bcmuslimgolfers.com � A � � � H I L � H � H K A Z � ("text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 525 14 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "8bit" 1114 25 NIL NIL NIL NIL) "alternative" ("boundary" "b1_LoHBKnLMn0uOPFBCm2TsG5Moil7f6EYjAWf60a1y5ZM") NIL NIL NIL E � �a � _ & From: =?UTF-8?B?2LXZhtin24zYuSDYotiz2KfZhtiz2YjYsSDZhdmE2qnbjA==?= <cs@malekilift.com> Q ( Message-ID: <ybe0MDs1tqPMas10fXzbLYnfVnHlXWc1Gb9Z0oqJuI0@malekilift.com> N " Subject: =?UTF-8?B?2KrYp9im24zYryDYr9ix24zYp9mB2Kog2LTaqdin24zYqg==?= ( - Content-Transfer-Encoding: 8bit h + Content-Type: multipart/alternative; boundary="b1_ybe0MDs1tqPMas10fXzbLYnfVnHlXWc1Gb9Z0oqJuI0" - % Date: Sat, 5 Feb 2022 23:42:43 +0000 $ ' Reply-To: cs@malekilift.com n Return-Path: <malekilift@linux7.jump-server.com> Return-path: <malekilift@linux7.jump-server.com> % ! To: info@bcmuslimgolfers.com � A � � � H I L � H � H K A Z � ("text" "plain" ("charset" "UTF-8") NIL NIL "8bit" 525 14 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "8bit" 1114 25 NIL NIL NIL NIL) "alternative" ("boundary" "b1_ybe0MDs1tqPMas10fXzbLYnfVnHlXWc1Gb9Z0oqJuI0") NIL NIL NIL M � �a � ; From: BOOM OF SALES <cvdklnijud@metagenics.com.au> V Message-ID: <b6241fb8-5b9e-4dbd-9c8c-3cfa90467f75@M-Hybrid.Metagenics.com.au> A ? Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Mon, 7 Feb 2022 19:50:09 +0300 - Reply-To: <contactardados@gmail.com> d Return-Path: <cvdklnijud@metagenics.com.au> Return-path: <cvdklnijud@metagenics.com.au> ( To: <john@givebooksnewlife.com> 0 ( H � � � � 7 G �Mb � � From: =?ISO-2022-JP?B?GyRCTkFNfTgmNWYySBsoQiAbJEJDZktcJWslajtSGyhCIBskQiUqJVUlIyU3JWMlayU1JSQlSBsoQg==?= <info@kitchen-t.jp> D Message-ID: <cca8acc0f846212e6c875a1051684d0a@kitchen-t.jp> i 6 Subject: ***SPAM*** =?ISO-2022-JP?B?GyRCJCpMZCQkOWckbyQ7JCIkaiQsJEgkJiQ0JDYkJCReJDkhIxsoQg==?= 6 Content-Type: text/plain; charset=ISO-2022-JP . Date: Thu, 10 Feb 2022 01:56:08 +0000 b Return-Path: <anonymous@chm3002.secure.jp> Return-path: <anonymous@chm3002.secure.jp> % To: info@bcmuslimgolfers.com ( H � � � � N "text" "plain" ("charset" "ISO-2022-JP") NIL NIL "7bit" 464 13 NIL NIL NIL NIL r �pb � 7 From: "Patrick Mason" <simusqfltjo@netplus.fr> M Message-Id: <20220327093621.6ACCD73885E@victoria.hosting.netplus.fr> H Subject: We have a very profitable business opportunity for you ! Content-Type: text/plain . Date: Sun, 27 Mar 2022 02:36:21 -0700 . Reply-To: patrickmason@pharmlabuk.com X Return-Path: <simusqfltjo@netplus.fr> Return-path: <simusqfltjo@netplus.fr> % To: info@bcmuslimgolfers.com 0 ( H I ' - 8 Y0@b � C From: "taurus financial investment" <uynvnpehm@netplus.fr> M Message-Id: <20220327093621.6CAB973885F@victoria.hosting.netplus.fr> * Subject: we have investment funds ! Content-Type: text/plain . Date: Sun, 27 Mar 2022 02:36:21 -0700 ? Reply-To: projectmanager@taurusfinancialinvestment.com T Return-Path: <uynvnpehm@netplus.fr> Return-path: <uynvnpehm@netplus.fr> " To: grantuchida@gmail.com 0 ( H ^ � � ' K Z0@b � - From: "INf4mation" <sjytd@noris.org> A Message-ID: <1285beb9b36c2eb5d1c40cbac9a198f9@noris.org> V : Subject: ***SPAM*** Our blockchain data privacy airdrop is live on Telegram ! Content-Type: text/plain . Date: Sun, 27 Mar 2022 12:26:15 -0700 2 Reply-To: acessenossositeabaixo@gmail.com J Return-Path: <sjytd@noris.org> Return-path: <sjytd@noris.org> ( To: devin.doherty@exprealty.com 0 ( H � � I b � ��@b N From: "Rangers Cleaning and contracting" <hkjkbitrljf@alnafea.com.sa> U Message-Id: <202203280102.22S125LW024256-22S125LY024256@mail.alnafea.com.sa> U 8 Subject: ***SPAM*** Affordable Janitorial / Cleaning Services in Indiana ! ! Content-Type: text/plain . Date: Sun, 27 Mar 2022 18:02:07 -0700 9 Reply-To: info@rangerscleaningandcontracting.com ` Return-Path: <hkjkbitrljf@alnafea.com.sa> Return-path: <hkjkbitrljf@alnafea.com.sa> ' To: info@aineimport-export.com 0 ( H � � � � A Ab � ; From: "Saint Perry" <rvqnwcc@send-your-emails.com> 8 > Subject: ***SPAM*** Valentine's Day Promotion ! Content-Type: text/plain . Date: Sun, 27 Mar 2022 12:26:16 -0700 2 Reply-To: acessenossositeabaixo@gmail.com d Return-Path: <rvqnwcc@send-your-emails.com> Return-path: <rvqnwcc@send-your-emails.com> % To: info@bcmuslimgolfers.com 0 ( H � � � � YAb 8 E ! From: "Taurus Financial Investment" <yzkvxqf@setnoticias.mx> G ' Message-Id: <20220330191533.B2C9A20237E40@mail.setnoticias.mx> C M Subject: ***SPAM*** =?utf-8?Q?Spam?= Financial services # Content-Type: text/html . % Date: Wed, 30 Mar 2022 12:15:40 -0700 6 $ Reply-To: admin@taurusfinancialinvestment.com X Return-Path: <yzkvxqf@setnoticias.mx> Return-path: <yzkvxqf@setnoticias.mx> + " To: info@versatiletreeservices.com ( H [ 1 K K "text" "html" ("charset" "us-ascii") NIL NIL "7bit" 1867 26 NIL NIL NIL NIL = H'Eb ( G ! From: Javi =?ISO-8859-1?Q?Cl=E0udia?= <mbuiks@setnoticias.mx> G ' Message-Id: <20220401010857.7703E20266BFC@mail.setnoticias.mx> J O Subject: ***SPAM*** =?utf-8?Q?Spam?= Bitcoin is your future!!! # Content-Type: text/html . % Date: Thu, 31 Mar 2022 18:09:06 -0700 + $ Reply-To: javiclaudia247@gmail.com V Return-Path: <mbuiks@setnoticias.mx> Return-path: <mbuiks@setnoticias.mx> " To: hola@goparket.com ( H c � + E K "text" "html" ("charset" "us-ascii") NIL NIL "7bit" 1349 26 NIL NIL NIL NIL � `Jb < ! From: "Global Resource" <zvcyjuwvpv@setnoticias.mx> G ) Message-Id: <20220331210512.3DE162034DD9B@mail.setnoticias.mx> @ " Subject: =?utf-8?Q?Spam?= We BUY YOUR OLD TVs and more % Content-Type: text/html . ' Date: Thu, 31 Mar 2022 14:05:20 -0700 % & Reply-To: specials@martx.com ^ Return-Path: <zvcyjuwvpv@setnoticias.mx> Return-path: <zvcyjuwvpv@setnoticias.mx> % $ To: info@bcmuslimgolfers.com ( H r � K "text" "html" ("charset" "us-ascii") NIL NIL "7bit" 1567 30 NIL NIL NIL NIL s +�Kb ` : From: "BOOM OF SALES" <dcmesmdzzz@luojichang.com> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 19 Aug 2021 15:02:23 -0700 + Reply-To: contactardados@gmail.com ^ Return-Path: <dcmesmdzzz@luojichang.com> Return-path: <dcmesmdzzz@luojichang.com> To: info@luxsartech.com 0 ( 3 n � � 7 � ��Kb � : From: "BITMAIN REPAIR CENTER" <uqxruq@jiuzhi.ltd> F 4 Subject: ***SPAM*** We repair machines using original parts ! Content-Type: text/plain . Date: Mon, 28 Mar 2022 00:51:53 -0700 2 Reply-To: acessenossositeabaixo@gmail.com N Return-Path: <uqxruq@jiuzhi.ltd> Return-path: <uqxruq@jiuzhi.ltd> ) To: hello@thecastingchambers.com 0 ( H M � � � � ��Lb � 3 From: "Global Resource" <rjxoxzfmb@lsi.ru> / Message-ID: <auto-000679907602@lsi.ru> . Subject: We BUY YOUR OLD TVs and more ! Content-Type: text/plain - Date: Sat, 9 Apr 2022 21:38:08 -0700 % Reply-To: specials@martx.com L Return-Path: <rjxoxzfmb@lsi.ru> Return-path: <rjxoxzfmb@lsi.ru> ! To: hydepark@esdpeds.com 0 ( H 4 k � � i_Rb � > From: "Taurus Financial Investment" <jnfuunfs@lsi.ru> / Message-ID: <auto-000680163238@lsi.ru> E Subject: Funding for credible clients with feasible projects ! Content-Type: text/plain . Date: Sun, 10 Apr 2022 16:34:26 -0700 7 Reply-To: taurusfinancialinvestments@gmail.com J Return-Path: <jnfuunfs@lsi.ru> Return-path: <jnfuunfs@lsi.ru> & To: hemppastedoctor@gmail.com 0 ( H � ( � � � �iSb � 8 From: "LK MOULD LTD " <ixcskhjepix@mowitel.net> 7 Message-Id: <E1ndh4S-0003AF-SE@ns1.mowitel.es> > Subject: Mold Manufacturing,Injection Molding service ! Content-Type: text/plain . Date: Sun, 10 Apr 2022 16:34:16 -0700 ) Reply-To: Lkmould@lk-tooling.com Z Return-Path: <ixcskhjepix@mowitel.net> Return-path: <ixcskhjepix@mowitel.net> % To: info@bcmuslimgolfers.com 0 ( H N � � � �iSb � = ! From: "Global Resource" <gbyhatbfvis@setnoticias.mx> G ' Message-Id: <20220408015601.C5B85204B9586@mail.setnoticias.mx> . " Subject: We BUY YOUR OLD TVs and more ! $ Content-Type: text/plain - & Date: Thu, 7 Apr 2022 18:56:18 -0700 % % Reply-To: specials@martx.com ` Return-Path: <gbyhatbfvis@setnoticias.mx> Return-path: <gbyhatbfvis@setnoticias.mx> . # To: clarenacentrodeestetica@gmail.com 0 ( H X � � � :db � F ! From: "Taurus Financial Investment" <ezqxpimu@setnoticias.mx> G ' Message-Id: <20220407154117.06E27216B3652@mail.setnoticias.mx> ? " Subject: We have investment funds for viable projects. ! $ Content-Type: text/plain - & Date: Thu, 7 Apr 2022 08:41:33 -0700 6 % Reply-To: taurusfinancialinvestment@gmail.com Z Return-Path: <ezqxpimu@setnoticias.mx> Return-path: <ezqxpimu@setnoticias.mx> " # To: emilykaya36@gmail.com 0 ( H � � � � � 4�nb $ 7 ! From: "LK MOULD LTD " <hsdqldh@setnoticias.mx> G ) Message-Id: <20220410043633.E883520E0D76A@mail.setnoticias.mx> P " Subject: =?utf-8?Q?Spam?= Mold Manufacturing,Injection Molding service % Content-Type: text/html - ' Date: Sat, 9 Apr 2022 21:36:52 -0700 ) & Reply-To: Lkmould@lk-tooling.com X Return-Path: <hsdqldh@setnoticias.mx> Return-path: <hsdqldh@setnoticias.mx> % $ To: info@bcmuslimgolfers.com ( H s � � K "text" "html" ("charset" "us-ascii") NIL NIL "7bit" 1041 26 NIL NIL NIL NIL j �8rb | 3 H From: Laura Wilson <lwilson@golfcanada.ca> f N Message-ID: <YT3PR01MB4900F153B293E1B4E84ACF3CB0C69@YT3PR01MB4900.CANPRD01.PROD.OUTLOOK.COM> / J Subject: BC Muslim Golfers Assocaition j = Content-Type: multipart/related; boundary="----_=_NextPart_e645a252-b41b-49fb-a820-2bdd5ca33c02" - M Date: Mon, 9 May 2022 20:30:57 +0000 V Return-Path: <lwilson@golfcanada.ca> Return-path: <lwilson@golfcanada.ca> B I To: "info@bcmuslimgolfers.com" <info@bcmuslimgolfers.com> � A U, �, Y� o� A �, � � �> �? H �- V Z � ( H �4 U Y h6 @7 � @ 5l T _ �( p) @ �� S ^ � � @ � S ^ k z @ ס S ^ � � @ � S ^ � (("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1804 40 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "quoted-printable" 14144 216 NIL NIL NIL NIL) "alternative" ("boundary" "_000_YT3PR01MB4900F153B293E1B4E84ACF3CB0C69YT3PR01MB4900CANP_") NIL ("en-US") NIL)("image" "png" ("name" "image038435.png") "<image038435.png@7AD50271.A3FA4CF1>" "image038435.png" "base64" 10608 NIL ("inline" ("creation-date" "Mon, 09 May 2022 20:31:01 +0000" "filename" "image038435.png" "modification-date" "Mon, 09 May 2022 20:31:01 +0000" "size" "7752")) NIL NIL)("image" "png" ("name" "image675409.png") "<image675409.png@80C89FF8.38668067>" "image675409.png" "base64" 954 NIL ("inline" ("creation-date" "Mon, 09 May 2022 20:31:01 +0000" "filename" "image675409.png" "modification-date" "Mon, 09 May 2022 20:31:01 +0000" "size" "694")) NIL NIL)("image" "png" ("name" "image823352.png") "<image823352.png@ACA66E99.7993E093>" "image823352.png" "base64" 1146 NIL ("inline" ("creation-date" "Mon, 09 May 2022 20:31:01 +0000" "filename" "image823352.png" "modification-date" "Mon, 09 May 2022 20:31:01 +0000" "size" "835")) NIL NIL)("image" "png" ("name" "image539906.png") "<image539906.png@7819A386.42EB63CA>" "image539906.png" "base64" 958 NIL ("inline" ("creation-date" "Mon, 09 May 2022 20:31:01 +0000" "filename" "image539906.png" "modification-date" "Mon, 09 May 2022 20:31:01 +0000" "size" "697")) NIL NIL)("image" "png" ("name" "image267642.png") "<image267642.png@2B483340.DCC11B44>" "image267642.png" "base64" 1052 NIL ("inline" ("creation-date" "Mon, 09 May 2022 20:31:01 +0000" "filename" "image267642.png" "modification-date" "Mon, 09 May 2022 20:31:01 +0000" "size" "767")) NIL NIL) "related" ("boundary" "----_=_NextPart_e645a252-b41b-49fb-a820-2bdd5ca33c02") NIL NIL NIL �� 6zyb ` 0 From: "SUPER LIST" <rmsnpg@visqual.com> P 9 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Mon, 30 May 2022 19:18:00 -0700 + Reply-To: contactardados@gmail.com P Return-Path: <rmsnpg@visqual.com> Return-path: <rmsnpg@visqual.com> . To: biancastinson@thecoachonthego.com 0 ( � � b � $ � ���b h 5 From: "SUPER LIST" <ctgaqlqrh@itkeeping.com> P 5 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sat, 11 Jun 2022 07:29:33 -0700 + Reply-To: contactardados@gmail.com Z Return-Path: <ctgaqlqrh@itkeeping.com> Return-path: <ctgaqlqrh@itkeeping.com> $ To: joseph.gruber@gmail.com 0 ( � � b � $ z|�b \ 7 ) From: Victoria Size <VictoriaSize@outlook.com> k . Message-ID: <SL2PR01MB3324A6EDC87603537D6CE3CCC4AA9@SL2PR01MB3324.apcprd01.prod.exchangelabs.com> * Subject: SEO ON Page w Z Content-Type: multipart/alternative; boundary="_000_SL2PR01MB3324A6EDC87603537D6CE3CCC4AA9SL2PR01MB3324apcp_" . - Date: Tue, 14 Jun 2022 11:26:01 +0000 \ Return-Path: <VictoriaSize@outlook.com> Return-path: <VictoriaSize@outlook.com> � A g% �% e � H �% ^ a u � H �( ] ` q � u ( ("text" "plain" ("charset" "Windows-1252") NIL NIL "quoted-printable" 652 23 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "quoted-printable" 5606 117 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SL2PR01MB3324A6EDC87603537D6CE3CCC4AA9SL2PR01MB3324apcp_") NIL ("en-US") NIL �> �p�b h * From: dsqirfc0 <dsqirfc0@163.com> J T Message-ID: <75c12d4f.153f.181896e496f.Coremail.dsqirfc0@163.com> . L Subject: =?UTF-8?B?54i25q+N5bm057qq?= Cc: "katie@katieamanda.com" <katie@katieamanda.com>, "ohioyouthgirlsbasketball@gmail.com" <ohioyouthgirlsbasketball@gmail.com>, "info@21stcenturykitchens.com" <info@21stcenturykitchens.com>, "info@meteoserv.com" <info@meteoserv.com>, "trilogyautos@gmail.com" <trilogyautos@gmail.com>, "myselfismycards@icloud.com" <myselfismycards@icloud.com>, "info@sherispeaks.com" <info@sherispeaks.com>, "info@primiscleaningservices.com" <info@primiscleaningservices.com>, "caringhandshomecares@gmail.com" <caringhandshomecares@gmail.com>, "sales@kontooncable.com" <sales@kontooncable.com>, "info@bihtertekstil.com" <info@bihtertekstil.com>, "3bsflagler@gmail.com" <3bsflagler@gmail.com>, "contact@streamlineprofessionals.com" <contact@streamlineprofessionals.com>, "info@kingslandfood.com" <info@kingslandfood.com>, "sales@smdgroup.com.my" <sales@smdgroup.com.my>, "jjscooterrepair@gmail.com" <jjscooterrepair@gmail.com>, "info@a2minds.com" <info@a2minds.com>, "sales@compumove.com" <sales@compumove.com>, "marvinschwartzsr@gmail.com" <marvinschwartzsr@gmail.com>, "13stringz@gmail.com" <13stringz@gmail.com>, "silutextkft@gmail.com" <silutextkft@gmail.com>, "info@bion.com.my" <info@bion.com.my>, "info@freshworzllc.com" <info@freshworzllc.com>, "aimmed420@gmail.com" <aimmed420@gmail.com>, "support@satafrik.com" <support@satafrik.com>, "info@leveragewindows.com" <info@leveragewindows.com>, "sales@masterengg.com" <sales@masterengg.com>, "6034x4@gmail.com" <6034x4@gmail.com>, "daniel@xtremeconcreteservices.com" <daniel@xtremeconcreteservices.com>, "sales@giamiasia.com" <sales@giamiasia.com>, "asiakym@yahoo.com" <asiakym@yahoo.com>, "chandalarlakelodge@gmail.com" <chandalarlakelodge@gmail.com>, "info@xpautopartslog.com" <info@xpautopartslog.com>, "info@huayhuashadventures.com" <info@huayhuashadventures.com>, "applebykd@gmail.com" <applebykd@gmail.com>, "apostoloskidental@gmail.com" <apostoloskidental@gmail.com>, "info@apostoloskidental.rs" <info@apostoloskidental.rs>, "malvestielectric@gmail.com" <malvestielectric@gmail.com>, "info@maumeeberners.com" <info@maumeeberners.com>, "sales@agrogroup.com.my" <sales@agrogroup.com.my>, "info@bcmuslimgolfers.com" <info@bcmuslimgolfers.com>, "dustitupcleaningpa@gmail.com" <dustitupcleaningpa@gmail.com>, "hector3torres@gmail.com" <hector3torres@gmail.com>, "info@etes.com.pk" <info@etes.com.pk>, "sales@etes.com.pk" <sales@etes.com.pk>, "info@royalstechnologyusa.com" <info@royalstechnologyusa.com>, "info@polderspace.com" <info@polderspace.com> ` Q Content-Type: multipart/related; boundary="----=_Part_16117_1895269150.1655868115311" : Date: Wed, 22 Jun 2022 11:21:55 +0800 (GMT+08:00) L Return-Path: <dsqirfc0@163.com> Return-path: <dsqirfc0@163.com> M X-Priority: 3 � A ! � l� �� A M Z ] � � H � K N 4 4 H y J M C r / @ _* � � @� l� � (("text" "plain" ("charset" "UTF-8") NIL NIL "base64" 52 0 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "base64" 3698 47 NIL NIL NIL NIL) "alternative" ("boundary" "----=_Part_16118_1210702.1655868115311") NIL NIL NIL)("image" "png" ("name" "axzs39.png") "<15bea030$1$181896e496d$Coremail$dsqirfc0$163.com>" NIL "base64" 183148 NIL ("inline" ("filename" "axzs39.png")) NIL NIL) "related" ("boundary" "----=_Part_16117_1895269150.1655868115311") NIL NIL NIL �� ���b \ 4 From: "SUPER LIST" <cyhksxkrj@hbnatong.com> P ; Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Thu, 30 Jun 2022 11:27:45 +0200 + Reply-To: contactardados@gmail.com X Return-Path: <cyhksxkrj@hbnatong.com> Return-path: <cyhksxkrj@hbnatong.com> To: info@bcmssystem.com 0 ( C b � $ i �Ҿb � > From: "The Conrad Press..." <pgwzzgnvna@hbnatong.com> } ? Subject: ***SPAM*** Have you written a book you want to see published or would you like your book ghost-written?. ! Content-Type: text/plain . Date: Wed, 27 Jul 2022 06:26:15 +0200 3 Reply-To: jamesessinger@theconradpress.com Z Return-Path: <pgwzzgnvna@hbnatong.com> Return-path: <pgwzzgnvna@hbnatong.com> To: info@bcmsolar.com 0 ( H : { { � � \�b H 3 From: "BOOM OF SALES" <mnots@hbnatong.com> A ? Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Tue, 26 Jul 2022 15:13:26 +0200 + Reply-To: contactardados@gmail.com P Return-Path: <mnots@hbnatong.com> Return-path: <mnots@hbnatong.com> To: info@bcmsolar.com 0 ( P � � 7 � ���b � 3 From: "SUPER LIST" <akyfgnujrq@shhvip.com> = Message-Id: <20220726224801.B59491B63075@shhvip.com> P 9 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Wed, 27 Jul 2022 00:47:51 +0200 + Reply-To: contactardados@gmail.com V Return-Path: <akyfgnujrq@shhvip.com> Return-path: <akyfgnujrq@shhvip.com> To: info@bcmssystem.com 0 ( q � b � $ � ���b X / From: "SUPER LIST" <gctuyrpu@ght.asia> P 6 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Tue, 9 Aug 2022 04:49:01 +0200 + Reply-To: contactardados@gmail.com N Return-Path: <gctuyrpu@ght.asia> Return-path: <gctuyrpu@ght.asia> ' To: kirtasiyedeppo@hotmail.com 0 ( � � b � $ �F�b X 9 ) From: Sarah Yusufsmo <SarahYusufsmo@hotmail.com> e . Message-ID: <ME3P282MB2449C28F8419882E355792B0BB749@ME3P282MB2449.AUSP282.PROD.OUTLOOK.COM> * Subject: Proposal w W Content-Type: multipart/alternative; boundary="_000_ME3P282MB2449C28F8419882E355792B0BB749ME3P282MB2449AUSP_" . - Date: Sat, 27 Aug 2022 09:31:39 +0000 ^ Return-Path: <SarahYusufsmo@hotmail.com> Return-path: <SarahYusufsmo@hotmail.com> � A �$ ]% * � H % \ _ x � H /) [ ^ 7 � { $ ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 916 28 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 6578 123 NIL NIL NIL NIL) "alternative" ("boundary" "_000_ME3P282MB2449C28F8419882E355792B0BB749ME3P282MB2449AUSP_") NIL ("en-GB") NIL C � c � 8 ? From: BOOM OF SALES <gxdxieru@prasarana.com.my> W C Message-ID: <5c884308-0433-471d-ac31-a2c3d9894b1c@MRL-EXH-02.prasarana.com.my> A � Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! E Content-Type: text/plain . B Date: Fri, 16 Sep 2022 16:49:59 +0200 - A Reply-To: <contactardados@gmail.com> ^ Return-Path: <gxdxieru@prasarana.com.my> Return-path: <gxdxieru@prasarana.com.my> ' @ To: <corporate@divvybikes.com> 0 ( H + �+ � > �0 J�$c ` 8 From: "BOOM OF SALES" <grgqvguwlw@alexstorm.ru> A 9 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 21 Sep 2022 16:52:35 +0200 + Reply-To: contactardados@gmail.com Z Return-Path: <grgqvguwlw@alexstorm.ru> Return-path: <grgqvguwlw@alexstorm.ru> & To: galoehjayaputra@yahoo.com 0 ( � � > � �%+c � 1 From: "BOOM OF SALES" <tuomur@eyviz.com> ? Message-Id: <20220922093505.285624855DF7@mail.gxas.cn> A : Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 22 Sep 2022 11:35:06 +0200 + Reply-To: contactardados@gmail.com L Return-Path: <tuomur@eyviz.com> Return-path: <tuomur@eyviz.com> 4 To: eric.perret@www.renaissance-conseil.com 0 ( � � � > u �H,c � 8 From: "BOOM OF SALES" <rhnnn@privateheberg.net> T # Message-Id: <A8C01756-FB4D-49CA-9761-2A081CFF1525.1@mail.privateheberg.net> A I Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Fri, 23 Sep 2022 12:27:29 +0200 + Reply-To: contactardados@gmail.com Z Return-Path: <rhnnn@privateheberg.net> Return-path: <rhnnn@privateheberg.net> $ To: carles.aguilo@gmail.com 0 ( I � � > So.c � ; / From: "Malam Zamani" <byragorway@jharkhand.gov.in> H 4 Message-Id: <20221002014403.30CAD29FEA0F@mail.jharkhand.gov.in> . V Subject: ***SPAM*** OFFICIAL TENDER ! 1 Content-Type: text/plain - 3 Date: Sun, 2 Oct 2022 03:44:05 +0200 + 2 Reply-To: malam_zamani_u@yahoo.com b Return-Path: <byragorway@jharkhand.gov.in> Return-path: <byragorway@jharkhand.gov.in> . 0 To: prenotazioni@theboxpoltuquatu.com 0 ( H � U i ,�9c H 3 # From: Nick Coetzee <nick@companydata.club> J % Message-ID: <fRBlZu34slSNDhqmToVq9XHPBak70lcWYIxBsY6Wo@localhost> , M Subject: ***SPAM*** LeadsTree.org * ( Content-Transfer-Encoding: base64 / ' Content-Type: text/html; charset=UTF-8 - ! Date: Thu, 6 Oct 2022 22:51:02 +0200 < $ Reply-To: "LeadsTree.org" <marketing@leadstree.org> V Return-Path: <nick@companydata.club> Return-path: <nick@companydata.club> % " To: info@bcmuslimgolfers.com ( H � � � � H "text" "html" ("charset" "UTF-8") NIL NIL "base64" 406 7 NIL NIL NIL NIL b@?c T - From: "JAMES COOPER" <zckatu@brt.tj> 5 4 Subject: ***SPAM*** INVESTMENT OPPORTUNITY ! Content-Type: text/plain . Date: Thu, 13 Oct 2022 19:21:03 +0200 & Reply-To: jrstgmaes@gmail.com F Return-Path: <zckatu@brt.tj> Return-path: <zckatu@brt.tj> " To: alexmloucks@gmail.com 0 ( H � � � � � �xHc H 4 From: Nick Coetzee <nick@marketingman6.com> I Message-ID: <PeK9Y0A2iHkQgsP0d5cwlEW4wKrtTobpC0ygxTY8@localhost> , A Subject: ***SPAM*** LeadsTree.org * Content-Transfer-Encoding: base64 / Content-Type: text/html; charset=UTF-8 . Date: Fri, 14 Oct 2022 02:19:37 +0200 < Reply-To: "LeadsTree.org" <marketing@leadstree.org> X Return-Path: <nick@marketingman6.com> Return-path: <nick@marketingman6.com> % To: info@bcmuslimgolfers.com ( H � , � � H "text" "html" ("charset" "UTF-8") NIL NIL "base64" 406 7 NIL NIL NIL NIL y J�Hc X 5 From: Nick Coetzee <nick@marketingman11.com> I Message-ID: <s0Ea45AMMttqIdvnx7pIEDWAbniop2lZiFWjPdf8@localhost> 0 < Subject: ***SPAM*** Order Fulfillment * Content-Transfer-Encoding: base64 / Content-Type: text/html; charset=UTF-8 . Date: Tue, 18 Oct 2022 02:39:01 +0200 : Reply-To: OrderFulfillment <jeremy@leadstree.org> Z Return-Path: <nick@marketingman11.com> Return-path: <nick@marketingman11.com> % To: info@bcmuslimgolfers.com ( H . k X h J "text" "html" ("charset" "UTF-8") NIL NIL "base64" 1128 16 NIL NIL NIL NIL � �Mc � @ From: BOOM OF SALES <lipgxevbe@mccormackbrokers.com.au> P Message-ID: <03b1a5a8-4fbc-4ef7-aadd-7b2f5746a135@DC01.mccormack.local> A 6 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain . Date: Fri, 21 Oct 2022 20:09:43 +0200 - Reply-To: <contactardados@gmail.com> n Return-Path: <lipgxevbe@mccormackbrokers.com.au> Return-path: <lipgxevbe@mccormackbrokers.com.au> % To: <info@kapaklikentas.com> 0 ( H � � � > | �Rc � 6 - From: "SUPER LIST" <owyqdxncnlq@smartstol.ru> G 1 Message-Id: <20221028025704.4CCC965D9431@mail.weldingrobot.ru> P [ Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . 0 Date: Fri, 28 Oct 2022 04:57:03 +0200 + / Reply-To: contactardados@gmail.com \ Return-Path: <owyqdxncnlq@smartstol.ru> Return-path: <owyqdxncnlq@smartstol.ru> % . To: info@bcmuslimgolfers.com 0 ( % � I * D 7N[c P 2 From: "BOOM OF SALES" <enveba@neoon.site> A 7 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Mon, 7 Nov 2022 18:29:51 +0100 + Reply-To: contactardados@gmail.com N Return-Path: <enveba@neoon.site> Return-path: <enveba@neoon.site> % To: info@bcmuslimgolfers.com 0 ( s � � > : RYic 9 From: SUPER LIST <wtjngqlugdw@segurosbrb.com.br> X Message-ID: <bcef06d2-1ea4-403f-b825-0b70dc29495c@SPEXCHANGE.segurosbrb.com.br> P > Subject: ***SPAM*** Email lists 100% VALID - Any country in the world ! Content-Type: text/plain . Date: Thu, 10 Nov 2022 20:28:19 -0800 - Reply-To: <contactardados@gmail.com> f Return-Path: <wtjngqlugdw@segurosbrb.com.br> Return-path: <wtjngqlugdw@segurosbrb.com.br> ) To: <info@exhibitionsociety.com> 0 ( H E I * % ��mc � 2 From: SUPER LIST <ashwigdcedn@net-cg.com> Q " Message-ID: <7465097a-e14e-4a8d-b166-c39fbe13ff09@US099XMB06.net-cg.com> P @ Subject: ***SPAM*** Email lists 100% VALID - Any country in the world 4 ' Content-Transfer-Encoding: quoted-printable 7 & Content-Type: text/plain; charset=WINDOWS-1252 . ! Date: Sun, 13 Nov 2022 13:30:32 -0800 - Reply-To: <contactardados@gmail.com> X Return-Path: <ashwigdcedn@net-cg.com> Return-path: <ashwigdcedn@net-cg.com> , To: <info@bcm-silvers-families.com> ( H � � 6 a + [ "text" "plain" ("charset" "WINDOWS-1252") NIL NIL "quoted-printable" 865 43 NIL NIL NIL NIL � *bqc � 8 From: "Dunni Cliff" <hyopbacomm@sensee-iot.com> N 5 Subject: ***SPAM*** The war has subsided BUT the Russians are still ! Content-Type: text/plain . Date: Fri, 11 Nov 2022 00:11:03 +0100 ) Reply-To: dunnicliff27@gmail.com ^ Return-Path: <hyopbacomm@sensee-iot.com> Return-path: <hyopbacomm@sensee-iot.com> % To: info@bcmuslimgolfers.com 0 ( H � � � F�uc � 0 * From: "Taurus Finv" <ysqjm@camwater.cm> D / Message-Id: <20221202223920.27F87425F9DC@mta01.camwater.cm> 5 T Subject: ***SPAM*** Do you need investors? ! , Content-Type: text/plain - . Date: Fri, 2 Dec 2022 14:39:22 -0800 ' - Reply-To: taurusfinv@gmail.com N Return-Path: <ysqjm@camwater.cm> Return-path: <ysqjm@camwater.cm> # + To: info@otagocatering.com 0 ( H C � � � 72�c � 4 5 From: "Saiyad Ali" <saiyad.ali@thebcma.com> B > Message-ID: <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> ) < Subject: CRA Registration Number � 7 Cc: "Irshad Siddeeq \(VP Sports & Recreation\)" <sports@thebcma.com>, "'Salah El-khatib \(General Treasurer\)'" <treasurer@thebcma.com>, "Mohammed Imtiaz Asin \(VP Youth & Development\)" <youth@thebcma.com> c @ Content-Type: multipart/alternative; boundary="----=_NextPart_000_00CF_01D90AFC.EDAB6790" - = Date: Thu, 8 Dec 2022 12:02:21 -0800 C ; In-Reply-To: <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> p : References: <00b001d90b3d$a124e2c0$e36ea840$@thebcma.com> <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> X Return-Path: <saiyad.ali@thebcma.com> Return-path: <saiyad.ali@thebcma.com> ' 6 To: <info@bcmuslimgolfers.com> � A � . � � H ( O S � � / H ' Z ^ � p ("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 1202 47 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 5511 112 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_00CF_01D90AFC.EDAB6790") NIL ("en-us") NIL �/ �B�c � 2 5 From: Irshad Siddeeq <sports@thebcma.com> Y 7 Message-ID: <CAGu9kciZVYNAjcoQOfM2b8+fbgRbjVmGCdSvcs=MULRfG-co_Q@mail.gmail.com> - 8 Subject: Re: CRA Registration Number � : Cc: info@bcmuslimgolfers.com, "Salah El-khatib (General Treasurer)" <treasurer@thebcma.com>, "Mohammed Imtiaz Asin (VP Youth & Development)" <youth@thebcma.com> U = Content-Type: multipart/alternative; boundary="000000000000b1b20f05ef595317" - 6 Date: Thu, 8 Dec 2022 15:23:27 -0800 C 4 In-Reply-To: <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> � 2 References: <00b001d90b3d$a124e2c0$e36ea840$@thebcma.com> <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> P Return-Path: <sports@thebcma.com> Return-path: <sports@thebcma.com> 0 9 To: Saiyad Ali <saiyad.ali@thebcma.com> � A f � � H � + - � ; H � V Y � B � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 1545 59 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 5141 66 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000b1b20f05ef595317") NIL NIL NIL �, *r�c � 2 5 From: Irshad Siddeeq <sports@thebcma.com> Y 7 Message-ID: <CAGu9kcgfWzJ9C8=U62vsWV6WmB5byNN3T=trJe-movVsp-sfZw@mail.gmail.com> - 8 Subject: Re: CRA Registration Number � : Cc: info@bcmuslimgolfers.com, "Salah El-khatib (General Treasurer)" <treasurer@thebcma.com>, "Mohammed Imtiaz Asin (VP Youth & Development)" <youth@thebcma.com> U = Content-Type: multipart/alternative; boundary="0000000000009e4ebc05ef595ef0" - 6 Date: Thu, 8 Dec 2022 15:26:31 -0800 C 4 In-Reply-To: <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> � 2 References: <00b001d90b3d$a124e2c0$e36ea840$@thebcma.com> <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> P Return-Path: <sports@thebcma.com> Return-path: <sports@thebcma.com> 0 9 To: Saiyad Ali <saiyad.ali@thebcma.com> � A � V A � H + - 2 o = H � V Y - q D � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 1647 61 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 5233 68 NIL NIL NIL NIL) "alternative" ("boundary" "0000000000009e4ebc05ef595ef0") NIL NIL NIL ?. �r�c ` 4 5 From: "Saiyad Ali" <saiyad.ali@thebcma.com> B > Message-ID: <00ab01d90c2c$0b91a910$22b4fb30$@thebcma.com> - < Subject: RE: CRA Registration Number � 7 Cc: <info@bcmuslimgolfers.com>, "'Salah El-khatib \(General Treasurer\)'" <treasurer@thebcma.com>, "'Mohammed Imtiaz Asin \(VP Youth & Development\)'" <youth@thebcma.com> ] @ Content-Type: multipart/mixed; boundary="----=_NextPart_000_00AC_01D90BE8.FD70B300" - = Date: Fri, 9 Dec 2022 16:12:09 -0800 Z ; In-Reply-To: <CAGu9kcgfWzJ9C8=U62vsWV6WmB5byNN3T=trJe-movVsp-sfZw@mail.gmail.com> � : References: <00b001d90b3d$a124e2c0$e36ea840$@thebcma.com> <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> <CAGu9kcgfWzJ9C8=U62vsWV6WmB5byNN3T=trJe-movVsp-sfZw@mail.gmail.com> X Return-Path: <saiyad.ali@thebcma.com> Return-path: <saiyad.ali@thebcma.com> 4 6 To: "'Irshad Siddeeq'" <sports@thebcma.com> � A � � �� @� A � \ _ i> �? H x X \ * � ~ H ' W [ 1 �1 � @ �N � � td �� � (("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 3240 126 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 12784 233 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_001_00AD_01D90BE8.FD70B300") NIL NIL NIL)("image" "png" ("name" "2022-12-09 (1).png") NIL NIL "base64" 822696 NIL ("attachment" ("filename" "2022-12-09 (1).png")) NIL NIL) "mixed" ("boundary" "----=_NextPart_000_00AC_01D90BE8.FD70B300") NIL ("en-us") NIL � ϓc 2 5 From: Irshad Siddeeq <sports@thebcma.com> Y 7 Message-ID: <CAGu9kciv68v_AbzWhUfSkCXawycxUn9qFoowJZ7JVrnm+essOg@mail.gmail.com> . 8 Subject: Fwd: CRA Registration Number O ; Content-Type: multipart/mixed; boundary="0000000000002b5ab805ef6f24dd" - 6 Date: Fri, 9 Dec 2022 17:24:59 -0800 C 4 In-Reply-To: <00ab01d90c2c$0b91a910$22b4fb30$@thebcma.com> 1 References: <00b001d90b3d$a124e2c0$e36ea840$@thebcma.com> <00b701d90b3e$e85f5520$b91dff60$@thebcma.com> <00ce01d90b3f$fbcea790$f36bf6b0$@thebcma.com> <CAGu9kcgfWzJ9C8=U62vsWV6WmB5byNN3T=trJe-movVsp-sfZw@mail.gmail.com> <00ab01d90c2c$0b91a910$22b4fb30$@thebcma.com> P Return-Path: <sports@thebcma.com> Return-path: <sports@thebcma.com> � 9 To: Saiyad Ali <saiyad.ali@thebcma.com>, Salah El-Khatib <treasurer@thebcma.com>, info@bcmuslimgolfers.com, Vice President Youth <youth@thebcma.com> � A e � c� �� A � N P d@ �A H � + - � C � H � V Y �1 o2 � @ UN � � sd �� � (("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 3651 138 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 12911 166 NIL NIL NIL NIL) "alternative" ("boundary" "0000000000002b5ab205ef6f24db") NIL NIL NIL)("image" "png" ("name" "2022-12-09 (1).png") "<184f9a0fa958ebce9011>" NIL "base64" 822694 NIL ("attachment" ("filename" "2022-12-09 (1).png")) NIL NIL) "mixed" ("boundary" "0000000000002b5ab805ef6f24dd") NIL NIL NIL ȳ #�c � 1 From: "SUPER LIST" <ruvcdofby@gmail.com> S Message-ID: <GENERATED-WASMISSING-1p6RDM-00GuPa-2b@idnode01.whmserver.com> P H Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sat, 17 Dec 2022 07:02:32 +0000 + Reply-To: contactardados@gmail.com R Return-Path: <ruvcdofby@gmail.com> Return-path: <ruvcdofby@gmail.com> To: arjun8lal@gmail.com 0 ( d � I * � �i�c P 3 From: "BOOM OF SALES" <wtdtylmv@gmail.com> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Fri, 23 Dec 2022 19:52:55 +0000 + Reply-To: contactardados@gmail.com P Return-Path: <wtdtylmv@gmail.com> Return-path: <wtdtylmv@gmail.com> % To: okbusinessweek@gmail.com 0 ( h � � > / T�c � 2 From: "BOOM OF SALES" <cxzzpae@eyviz.com> ? Message-Id: <20221008142705.8B32D4A879F7@mail.gxas.cn> A 9 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Sat, 8 Oct 2022 16:27:07 +0200 + Reply-To: contactardados@gmail.com N Return-Path: <cxzzpae@eyviz.com> Return-path: <cxzzpae@eyviz.com> To: pavelglac@gmail.com 0 ( I � � > ���c � 1 From: "BOOM OF SALES" <sftweo@eyviz.com> ? Message-Id: <20221008142703.D74484A879C9@mail.gxas.cn> A 7 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Sat, 8 Oct 2022 16:27:05 +0200 + Reply-To: contactardados@gmail.com L Return-Path: <sftweo@eyviz.com> Return-path: <sftweo@eyviz.com> % To: info@bcmuslimgolfers.com 0 ( � � > � 㚸c t : From: Claudia Morris <claudia@marketingman11.com> K Message-ID: <PAl4NL6eYJQdMKFoC2v96lMa3T6o3Ge8QmWalQdNT0@localhost> = ? Subject: ***SPAM*** Get listed in 10k+ directories * Content-Transfer-Encoding: base64 / Content-Type: text/html; charset=UTF-8 . Date: Sat, 21 Jan 2023 19:45:35 +0100 > Reply-To: "DirectoryRegistar.com" <claudia@mxvia.com> ` Return-Path: <claudia@marketingman11.com> Return-path: <claudia@marketingman11.com> % To: info@bcmuslimgolfers.com ( H � � � � I "text" "html" ("charset" "UTF-8") NIL NIL "base64" 722 11 NIL NIL NIL NIL S 3�c L 1 From: "BOOM OF SALES" <yrcqr@acgvip.com> A < Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Sat, 4 Feb 2023 09:26:53 +0100 + Reply-To: contactardados@gmail.com L Return-Path: <yrcqr@acgvip.com> Return-path: <yrcqr@acgvip.com> & To: daniel@danieliannelli.com 0 ( � � > � QM�c \ 1 From: "SUPER LIST" <oejvzrkn@acgvip.com> P < Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Sun, 5 Feb 2023 10:03:24 +0100 + Reply-To: contactardados@gmail.com R Return-Path: <oejvzrkn@acgvip.com> Return-path: <oejvzrkn@acgvip.com> " To: info@savorourcity.com 0 ( � % I * G�d � : From: Louis Vuitton <phhvvwvbj@energo-serwis.com> o Message-ID: <cuvvbpgtyrnsznezrphnma.ozvzwrrxgqzhbzrwnaa@mail.squirrelenergo-serwis.com.design.co.uk.m> q = Subject: ***SPAM*** Louis Vuitton Handbags Start at $99 - Discounted Handbags For A Limited Time Only! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Wed, 22 Mar 2023 02:02:52 -0330 b Return-Path: <phhvvwvbj@energo-serwis.com> Return-path: <phhvvwvbj@energo-serwis.com> , To: info <info@bcmuslimgolfers.com> ( H 7 u �K �L j V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 19697 362 NIL NIL NIL NIL �W ,�d � : From: "Pamela Schulz" <pamela_schulz@outlook.com> B Message-ID: <20230326140543.CE5BBF05F2721A4B@outlook.com> Q O Subject: ***SPAM*** RE: Are these 4 myths killing your stamina in bed? 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 26 Mar 2023 14:05:43 -0300 ? Disposition-Notification-To: pamela_schulz@outlook.com , Reply-To: pamela_schulz@outlook.com ^ Return-Path: <pamela_schulz@outlook.com> Return-path: <pamela_schulz@outlook.com> % To: info@bcmuslimgolfers.com ( H � � �3 �4 � [ "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 13477 251 NIL NIL NIL NIL 4D �{ d � < From: Louis Vuitton <duberjpcaw@chelseastories.com> � Message-ID: <awecxxxykyluznulbkbucbzlbvofoitwbljyjwu-bvmpthpjwhzzkdbjfwfg.iuieugosohktwloa.nupcfhxufw@mchelseastoriesx.camstangpedemc.ac.uk.ziggo.nl> O C Subject: ***SPAM*** New Styles for 2023. Louis Vuitton bags only $99 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Fri, 31 Mar 2023 12:07:26 -0330 f Return-Path: <duberjpcaw@chelseastories.com> Return-path: <duberjpcaw@chelseastories.com> , To: info <info@bcmuslimgolfers.com> ( H � # �B �C W V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17373 343 NIL NIL NIL NIL eP b�&d ` 2 From: "SUPER LIST" <urzgyjdl@lged.gov.bd> P ? Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 31 Mar 2023 19:16:14 +0100 + Reply-To: contactardados@gmail.com T Return-Path: <urzgyjdl@lged.gov.bd> Return-path: <urzgyjdl@lged.gov.bd> % To: info@bcmuslimgolfers.com 0 ( � � � $ � �1'd X 6 From: Louis Vuitton <ynlqpj@cbdtastebuds.com> ` Message-ID: <knoeotrvvjbiahkaefdzzxlxlkd.yzsixaqlwnbiujthcjxpbbeqlts@smtp-in.orange.fr> D > Subject: ***SPAM*** Don't Wait - $120 LV Bags on Sale Now Z Content-Type: multipart/alternative; boundary="----=_001_f49064dc0eb0178a_=----" . Date: Sat, 15 Apr 2023 02:24:15 -0330 Z Return-Path: <ynlqpj@cbdtastebuds.com> Return-path: <ynlqpj@cbdtastebuds.com> , To: info <info@bcmuslimgolfers.com> � A � � 7V �W H � X \ � � + H � W [ lN �O t � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1707 43 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 20448 372 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_f49064dc0eb0178a_=----") NIL NIL NIL �b /.:d \ 8 From: Louis Vuitton <duifpmqt@cbdtastebuds.com> ` Message-ID: <besoieidubvddvdkdfvxadczmzr.nyqcshpzggjankbehovsnsrrnoq@smtp-in.orange.fr> D C Subject: ***SPAM*** Don't Wait - $120 LV Bags on Sale Now Z Content-Type: multipart/alternative; boundary="----=_001_817f2303b0b30493_=----" . Date: Fri, 21 Apr 2023 22:37:02 -0330 ^ Return-Path: <duifpmqt@cbdtastebuds.com> Return-path: <duifpmqt@cbdtastebuds.com> , To: info <info@bcmuslimgolfers.com> � A � � 3V �W H X \ � � + H W [ hN �O t � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1707 43 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 20444 372 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_817f2303b0b30493_=----") NIL NIL NIL �c 3Cd l 7 $ From: Sarah Johnson <sarah@marketingman20.com> J & Message-ID: <coxZHjRks7iqA2JxKwSayOS75JRKR0Oj04oOSW6es@localhost> = X Subject: ***SPAM*** Datalist2023.com Shutting Down * ) Content-Transfer-Encoding: base64 / ( Content-Type: text/html; charset=UTF-8 . " Date: Sat, 22 Apr 2023 12:26:49 +0200 @ % Reply-To: "DataList2023.com" <sarah@marketingman20.com> \ Return-Path: <sarah@marketingman20.com> Return-path: <sarah@marketingman20.com> % # To: info@bcmuslimgolfers.com ( H 7 � E Z J "text" "html" ("charset" "UTF-8") NIL NIL "base64" 1626 21 NIL NIL NIL NIL | ��Cd P - ! From: "Ronald Scott"<pat@kiprik.com> A $ Message-ID: <20230426220225.78531EF672D72436@kiprik.com> > T Subject: ***SPAM*** Personal Investment Opportunity 4 ( Content-Transfer-Encoding: quoted-printable 7 & Content-Type: text/html; charset="iso-8859-1" ) # Date: 26 Apr 2023 22:02:26 -0700 + Reply-To: ronaldscott145@gmail.com H Return-Path: <pat@kiprik.com> Return-path: <pat@kiprik.com> % " To: info@bcmuslimgolfers.com ( H � � ^ � J Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 5032 74 NIL NIL NIL NIL �$ Jd ` / From: Louis Vuitton <er@muchclubs.com> j Message-ID: <kcvsnwyygktldftqelzfxrgatsscxg.wcgjpnkknzxsmoynqbeoznqakrlcqn@isollyplv.coms-st.com> O B Subject: ***SPAM*** Save Big on LV Bags - Don't Miss Out. Only $100. 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 29 Apr 2023 07:39:04 -0330 L Return-Path: <er@muchclubs.com> Return-path: <er@muchclubs.com> , To: info <info@bcmuslimgolfers.com> ( H � ; 3 4 V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 13325 265 NIL NIL NIL NIL �? ��Ld � 0 From: "BOOM OF SALES" <bpfvx@gmail.com> @ Message-Id: <20230504000726.A8B93BE16A2@mail.lshou.com> A S Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Wed, 3 May 2023 17:08:38 -0700 + Reply-To: contactardados@gmail.com J Return-Path: <bpfvx@gmail.com> Return-path: <bpfvx@gmail.com> % To: info@bcmuslimgolfers.com 0 ( Y � 5 c . � Sd � 5 From: Louis Vuitton <wtsxxjk@acceptlook.com> � Message-ID: <zehgkhfnpryteoqolxvjqwrqbllgphzaytvredudwqeq.ooaghdiozonjbbfooqjwbmmkyagdtwbjijvymeqwsmen@acceptlook.com.lwalv.com> A H Subject: ***SPAM*** Huge LV Bag Sale - Save Big Today. 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 6 May 2023 09:40:02 -0330 X Return-Path: <wtsxxjk@acceptlook.com> Return-path: <wtsxxjk@acceptlook.com> , To: info <info@bcmuslimgolfers.com> ( H � � �Q S � V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 21375 399 NIL NIL NIL NIL �` �CVd � = From: Louis Vuitton <ccxyiod@laboratuvartezgahi.com> ` Message-ID: <hdnbnjjzbqfshfjdxxigyf.vfexdhnizhdplwdebpahuvvdxudybjrfrvs@mx.nagaomi.com> \ ? Subject: ***SPAM*** Shop Our Massive LV Bag Sale and Save Big. LV Bag $100 Today! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 13 May 2023 10:42:39 -0330 h Return-Path: <ccxyiod@laboratuvartezgahi.com> Return-path: <ccxyiod@laboratuvartezgahi.com> , To: info <info@bcmuslimgolfers.com> ( H � � %M �N } V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 20130 381 NIL NIL NIL NIL �Y �_d � ; From: "Eduardo Patini" <eduardopatini@outlook.com> B Message-ID: <20230516104928.F7B767B52D6241A6@outlook.com> [ N Subject: ***SPAM*** Turn Your Social Media Presence into a Lucrative Side Hustle 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 16 May 2023 10:49:28 -0300 2 Reply-To: eduardopatini_reply@outlook.com ^ Return-Path: <eduardopatini@outlook.com> Return-path: <eduardopatini@outlook.com> % To: info@bcmuslimgolfers.com ( H U � � ? i Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 6207 105 NIL NIL NIL NIL +( �cd � 7 " From: "SUPER LIST" <bgomahvw@netonline.net.br> B & Message-Id: <20230515212913.B9A5D8DA166A@mx.itans.com.br> P D Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . % Date: Mon, 15 May 2023 14:51:33 -0700 + $ Reply-To: contactardados@gmail.com ^ Return-Path: <bgomahvw@netonline.net.br> Return-path: <bgomahvw@netonline.net.br> # To: info@opengate.com 0 ( � � I * � ��cd � ; From: "Eduardo Patini" <eduardopatini@outlook.com> B Message-ID: <20230517105518.738396F4B1C79595@outlook.com> a H Subject: ***SPAM*** Achieve Your Dream Body with Our Revolutionary Weight Loss Product 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 17 May 2023 10:55:18 -0300 , Reply-To: eduardopatini@outlook.com ^ Return-Path: <eduardopatini@outlook.com> Return-path: <eduardopatini@outlook.com> % To: info@bcmuslimgolfers.com ( H � G Y � ~ Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 7127 126 NIL NIL NIL NIL W* ��dd P 2 From: "BOOM OF SALES" <axaccr@jiuzhi.ltd> A 8 Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 17 May 2023 22:33:41 -0300 + Reply-To: contactardados@gmail.com N Return-Path: <axaccr@jiuzhi.ltd> Return-path: <axaccr@jiuzhi.ltd> % To: info@bcmuslimgolfers.com 0 ( - f � > � �ed � 6 * From: "BOOM OF SALES" <hnsvuhnj@itans.com.br> B . Message-Id: <20230518011121.6981A9786256@mx.itans.com.br> A Z Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . - Date: Wed, 17 May 2023 22:33:43 -0300 + , Reply-To: contactardados@gmail.com V Return-Path: <hnsvuhnj@itans.com.br> Return-path: <hnsvuhnj@itans.com.br> + To: brabazonlaw@msn.com 0 ( � G � > � d�gd � < From: Louis Vuitton <dwibodbfy@kenyatopreviews.com> � Message-ID: <tlkxjvjhjirbexqwanpmaoplspmecjaifuylqmy.iyayrhovpqptdakwyovjlorfpqvbblrzv@HYDRkenyatopreviews.comOGEN.NS.HETZNER.COM> ^ B Subject: ***SPAM*** The Ultimate LV Bags Sale: Don't Let These Discounts Slip Away! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 20 May 2023 08:26:25 -0330 f Return-Path: <dwibodbfy@kenyatopreviews.com> Return-path: <dwibodbfy@kenyatopreviews.com> , To: info <info@bcmuslimgolfers.com> ( H i � nD �E H V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17846 328 NIL NIL NIL NIL �Q ��hd d 5 From: "SUPER LIST" <romumjqzhr@jsznkjgs.top> P ? Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sun, 21 May 2023 18:55:49 -0700 + Reply-To: contactardados@gmail.com Z Return-Path: <romumjqzhr@jsznkjgs.top> Return-path: <romumjqzhr@jsznkjgs.top> To: sales@yyyyjx.com 0 ( � � I * � ��jd ` 2 From: "SUPER LIST" <lpnkxcwe@eyes.travel> P > Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Wed, 24 May 2023 19:45:49 -0700 + Reply-To: contactardados@gmail.com T Return-Path: <lpnkxcwe@eyes.travel> Return-path: <lpnkxcwe@eyes.travel> % To: info@bcmuslimgolfers.com 0 ( x � I * � ��nd � L = From: =?utf-8?Q?elsmit=5Fretfa=5F757?= <elsmit_retfa_757@yahoo.com> E n Message-ID: <2CB1C7F6-C510-4DCD-9ECE-22F6F4D15272@yahoo.com> & o Subject: =?utf-8?B?5Zm25Li6?= Q s Content-Type: multipart/related; boundary="=_mailmaster-647070f1_0_29_=" . < Date: Fri, 26 May 2023 16:42:25 +0800 I t References: <2CB1C7F6-C510-4DCD-9ECE-22F6F4D15272.ref@yahoo.com> ` Return-Path: <elsmit_retfa_757@yahoo.com> Return-path: <elsmit_retfa_757@yahoo.com> O > To: =?utf-8?Q?info=40stuartandpierce.com.au?= <info@stuartandpierce.com.au>, =?utf-8?Q?servicetreecare=40yahoo.com?= <servicetreecare@yahoo.com>, =?utf-8?Q?ksolomonag=40gmail.com?= <ksolomonag@gmail.com>, =?utf-8?Q?info=40clpwm.com?= <info@clpwm.com>, =?utf-8?Q?contact=40citysidemn.com?= <contact@citysidemn.com>, =?utf-8?Q?wallservices=40aol.com?= <wallservices@aol.com>, =?utf-8?Q?foxshowservices=40gmail.com?= <foxshowservices@gmail.com>, =?utf-8?Q?centuryplaza=40yahoo.com?= <centuryplaza@yahoo.com>, =?utf-8?Q?rockcreekturf=40gmail.com?= <rockcreekturf@gmail.com>, =?utf-8?Q?info=40floridafundamentals.com?= <info@floridafundamentals.com>, =?utf-8?Q?karan=40krishankaran.com?= <karan@krishankaran.com>, =?utf-8?Q?royalflushhouse=40hotmail.com?= <royalflushhouse@hotmail.com>, =?utf-8?Q?sales=40athleticls.com?= <sales@athleticls.com>, =?utf-8?Q?info=40onleydesirables.com?= <info@onleydesirables.com>, =?utf-8?Q?jnbappliance=40aol.com?= <jnbappliance@aol.com>, =?utf-8?Q?jodiebevis=40gmail.com?= <jodiebevis@gmail.com>, =?utf-8?Q?info=40mmmhoffa.com?= <info@mmmhoffa.com>, =?utf-8?Q?myritecarepharmacy=40yahoo.com?= <myritecarepharmacy@yahoo.com>, =?utf-8?Q?imagineeyewear=40gmail.com?= <imagineeyewear@gmail.com>, =?utf-8?Q?mavridisch=40hotmail.com?= <mavridisch@hotmail.com>, =?utf-8?Q?totallycared4=40gmail.com?= <totallycared4@gmail.com>, =?utf-8?Q?barry.owen2215=40outlook.com?= <barry.owen2215@outlook.com>, =?utf-8?Q?kathyborn=40aol.com?= <kathyborn@aol.com>, =?utf-8?Q?jbraude=40ci.cambridge.ma.us?= <jbraude@ci.cambridge.ma.us>, =?utf-8?Q?info=40bcmuslimgolfers.com?= <info@bcmuslimgolfers.com>, =?utf-8?Q?info=40admissions1.com?= <info@admissions1.com>, =?utf-8?Q?info=40letragrafic.com.au?= <info@letragrafic.com.au>, =?utf-8?Q?sanchez=5Fruss=40hotmail.com?= <sanchez_russ@hotmail.com>, =?utf-8?Q?emailinfo=40nodakdesign.com?= <emailinfo@nodakdesign.com>, =?utf-8?Q?ywhipple=40kwlegacyranch.com?= <ywhipple@kwlegacyranch.com>, =?utf-8?Q?chelseaflyart=40gmail.com?= <chelseaflyart@gmail.com>, =?utf-8?Q?info=40raggededgedesigns.com?= <info@raggededgedesigns.com>, =?utf-8?Q?sales=40menusys.com?= <sales@menusys.com>, =?utf-8?Q?support=40menusys.com?= <support@menusys.com>, =?utf-8?Q?ij2215=40yahoo.com?= <ij2215@yahoo.com>, =?utf-8?Q?hannahmaccello=40gmail.com?= <hannahmaccello@gmail.com>, =?utf-8?Q?info=40optisell.com?= <info@optisell.com>, =?utf-8?Q?sales=40stellarflyinc.com?= <sales@stellarflyinc.com>, =?utf-8?Q?roamingcitizen=40gmail.com?= <roamingcitizen@gmail.com>, =?utf-8?Q?info=40hansonmedical.com?= <info@hansonmedical.com>, =?utf-8?Q?tbtauto=40gmail.com?= <tbtauto@gmail.com>, =?utf-8?Q?info=40hocltd.com?= <info@hocltd.com>, =?utf-8?Q?info=40madison31.com?= <info@madison31.com>, =?utf-8?Q?wang=5Fhuazhen=40yahoo.com?= <wang_huazhen@yahoo.com>, =?utf-8?Q?support=40mitechnologiesinc.com?= <support@mitechnologiesinc.com>, =?utf-8?Q?pipertomfittis=40gmail.com?= <pipertomfittis@gmail.com>, =?utf-8?Q?churchoffice120=40gmail.com?= <churchoffice120@gmail.com>, =?utf-8?Q?cargo=40hkairlines.com?= <cargo@hkairlines.com> � A �) �* �. @ H * L O q � - @ �7 � � � �0 . ("text" "html" ("charset" "utf-8") NIL NIL "base64" 3486 45 NIL NIL NIL NIL)("image" "png" ("name" "cvvcc07.png") "<EDE7014F-AA9E-4266-908F-C95ED58298C6@mailmaster>" NIL "base64" 340216 NIL ("inline" ("filename" "cvvcc07.png")) NIL NIL) "related" ("boundary" "=_mailmaster-647070f1_0_29_=") NIL NIL NIL �X @qpd � ; From: "BOOM OF SALES" <cfbcnphjdc@58jianli163.com> K Message-ID: <358453F7-9246-4563-8ADE-836FDFD3C0B2@58jianli163.com> A ; Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Tue, 23 May 2023 04:22:12 -0300 + Reply-To: contactardados@gmail.com ` Return-Path: <cfbcnphjdc@58jianli163.com> Return-path: <cfbcnphjdc@58jianli163.com> % To: info@bcmuslimgolfers.com 0 ( � % � ? � x�qd � 9 From: Louis Vuitton <jkpymi@kenyatopreviews.com> � Message-ID: <fgxmnciebztngfrjlreqjcphnhzrsinhcyruaiz.svtjurivotnthhnsypjkbpweijronfumm@HYDRkenyatopreviews.comOGEN.NS.HETZNER.COM> ^ B Subject: ***SPAM*** The Ultimate LV Bags Sale: Don't Let These Discounts Slip Away! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 27 May 2023 08:46:50 -0330 ` Return-Path: <jkpymi@kenyatopreviews.com> Return-path: <jkpymi@kenyatopreviews.com> , To: info <info@bcmuslimgolfers.com> ( H [ � jD �E H V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17842 328 NIL NIL NIL NIL �Q ��qd � ; From: "Eduardo Patini" <eduardopatini@outlook.com> B Message-ID: <20230602025806.75EE81D7888BE466@outlook.com> P K Subject: ***SPAM*** Unlock Your True Beauty with "Secret of the Alps" 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 2 Jun 2023 02:58:07 -0300 , Reply-To: eduardopatini@outlook.com ^ Return-Path: <eduardopatini@outlook.com> Return-path: <eduardopatini@outlook.com> % To: info@bcmuslimgolfers.com ( H � � � % Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1259 37 NIL NIL NIL NIL � �yd � 5 From: Louis Vuitton <gqdfhufdf@lanrenhg.com> � Message-ID: <abaqdfoubdhwbsynivylswonrccqfceo.picvyblzvufwvisehwbtrfjrgffvdwchmuangzktmm@ns1.exoscaldfg454sae.iomx.nagaomi.com> M F Subject: ***SPAM*** LV Bags $149 Now! LV Bags at Unmatched Prices! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 3 Jun 2023 07:53:52 -0330 X Return-Path: <gqdfhufdf@lanrenhg.com> Return-path: <gqdfhufdf@lanrenhg.com> , To: info <info@bcmuslimgolfers.com> ( H . u 2? i@ 7 V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16489 311 NIL NIL NIL NIL `M �{d � ; From: Louis Vuitton <rgpetjyf@itcareerbuilder.com> � Message-ID: <femkygzrwdxbcytdzswvvaltjboolgbv.owwjitdunlvcfmcmorywhdlbhi@itcareerbuilder.com.mail.groupchatoo.com.lyqlv.com.raintake.com> m B Subject: ***SPAM*** Limited Stock Alert: Louis Vuitton Bags at Unbeatable Prices - Don't Miss Out! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 10 Jun 2023 09:03:19 -0330 d Return-Path: <rgpetjyf@itcareerbuilder.com> Return-path: <rgpetjyf@itcareerbuilder.com> , To: info <info@bcmuslimgolfers.com> ( H � � �? )A : V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16681 314 NIL NIL NIL NIL �M �_�d � 0 From: "Boom Of Sales" <tsoe8@gmail.com> L Message-ID: <GENERATED-WASMISSING-1q8srf-004Tp3-Hv@vps29.lokoz.net> , G Subject: ***SPAM*** Boom Of Sales ! Content-Type: text/plain . Date: Mon, 12 Jun 2023 22:30:32 -0300 J Return-Path: <tsoe8@gmail.com> Return-path: <tsoe8@gmail.com> % To: info@bcmuslimgolfers.com X-Priority: 5 0 ( H � 8 e - � �Ƈd | 9 From: "BOOM OF SALES" <pzjurj@cfernandes.com.br> A C Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 15 Jun 2023 05:51:36 -0700 Reply-To: none � Return-Path: <btv1==53052488e2b==pzjurj@cfernandes.com.br> Return-path: <btv1==53052488e2b==pzjurj@cfernandes.com.br> + To: alfonsogarcia@stingraycafe.com 0 ( � + 5 c . � �d � 7 * From: "BOOM OF SALES" <ntgbirkdbn@camwater.cm> D . Message-Id: <20230615125347.DDD04422456C@mta01.camwater.cm> A Y Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . - Date: Thu, 15 Jun 2023 05:53:48 -0700 ) , Reply-To: none@mta01.camwater.cm X Return-Path: <ntgbirkdbn@camwater.cm> Return-path: <ntgbirkdbn@camwater.cm> + + To: alfonsogarcia@stingraycafe.com 0 ( � - 5 c . �>�d � : From: Louis Vuitton <puytqfvql@nlfunnyvideos.com> � Message-ID: <fakrukbvanxvfgeobrtojffjuldt.xhskencqkhbdloavsaqxdfhfqgzmnzxifzelguw@isnlfunnyvideos.com.ol.9cigkoftecicengiz.com989898plus-st.com> ^ B Subject: ***SPAM*** Unbelievable Offer: Louis Vuitton Bags at Only $150 - Shop Now! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 17 Jun 2023 08:36:06 -0330 b Return-Path: <puytqfvql@nlfunnyvideos.com> Return-path: <puytqfvql@nlfunnyvideos.com> , To: info <info@bcmuslimgolfers.com> ( H f � 7r 5t � V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 29749 510 NIL NIL NIL NIL � ܓ�d � 2 From: "SUPER LIST" <nxnbl@nancomtech.com> J Message-ID: <E17850BDAF6D486AA95D1A243EFA5F12.MAI@nancomtech.com> R 2 Subject: ***SPAM*** 100% VALID email lists of any country in the world. . Date: Sun, 18 Jun 2023 15:08:42 -0700 T Return-Path: <nxnbl@nancomtech.com> Return-path: <nxnbl@nancomtech.com> ' To: elliecollin@googlemail.com 0 ( � 0 U * R Ӯ�d � 7 From: "SUPER LIST" <mxkcqpflpq@nancomtech.com> J Message-ID: <D4EA0B4AC5F6450C920D5A9C3F81D06A.MAI@nancomtech.com> R 5 Subject: ***SPAM*** 100% VALID email lists of any country in the world. . Date: Mon, 19 Jun 2023 06:23:19 -0700 ^ Return-Path: <mxkcqpflpq@nancomtech.com> Return-path: <mxkcqpflpq@nancomtech.com> ( To: info@divinebeautyseries.com 0 ( � U * $ Sʐd ` : From: "Boom Of Sales" <ezc4jr@cuttingexperts.com> 3 9 Subject: ***SPAM*** Boom Of Salescc9nwbs ! Content-Type: text/plain . Date: Fri, 23 Jun 2023 19:17:46 -0300 ^ Return-Path: <ezc4jr@cuttingexperts.com> Return-path: <ezc4jr@cuttingexperts.com> To: info@bcm-tech.com X-Priority: 5 0 ( H ( b � � 0 � p�d p / From: Louis Vuitton <ghdria@i0633.net> ` Message-ID: <capkzkefjzftpljphjipaqlhactdhakmcodma.toapjnwxnpnhonliifxojrami@i0633.net> i F Subject: ***SPAM*** Your Chance to Own Louis Vuitton Bags: Incredible Prices Starting at $150! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 24 Jun 2023 08:28:56 -0330 L Return-Path: <ghdria@i0633.net> Return-path: <ghdria@i0633.net> , To: info <info@bcmuslimgolfers.com> ( H P mL �M | V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 19945 380 NIL NIL NIL NIL vZ �̖d x > From: "Boom Of Sales" <zszea3@linncountyprinting.net> 4 : Subject: ***SPAM*** Boom Of Sales9olubtwn ! Content-Type: text/plain . Date: Mon, 26 Jun 2023 05:55:04 -0300 f Return-Path: <zszea3@linncountyprinting.net> Return-path: <zszea3@linncountyprinting.net> * To: info@countryblindssuffolk.com X-Priority: 5 0 ( H � � � � 0 �R�d x 1 From: Louis Vuitton <lgibmuf@chic-e.net> W Message-ID: <tlhncgxfgleygy7a1l3b8aaxpisl.ast2ldtzehue9o16jd8zkyd5@chic-e.net> q @ Subject: ***SPAM*** Exclusive Bargain: Louis Vuitton Bags at an Unbeatable Price - Starting from $150! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 1 Jul 2023 12:54:18 -0330 P Return-Path: <lgibmuf@chic-e.net> Return-path: <lgibmuf@chic-e.net> , To: info <info@bcmuslimgolfers.com> ( H � � �[ r] � V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 23922 432 NIL NIL NIL NIL Wh ZE�d 4 3 # From: "SUPER LIST" <gekhrnegghz@gmail.com> P I Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - % Date: Sat, 1 Jul 2023 07:51:00 -0300 V Return-Path: <gekhrnegghz@gmail.com> Return-path: <gekhrnegghz@gmail.com> # $ To: booking.kuzz@gmail.com 0 ( ? � K + _ B�d d 6 # From: Sarah Johnson <sarah@marketingman2.com> H % Message-ID: <FzHbl61pIWUsTruy9MVksm1p8drDdFbCAkjneAo@localhost> = W Subject: ***SPAM*** DataList2023.com Shutting Down * ( Content-Transfer-Encoding: base64 / ' Content-Type: text/html; charset=UTF-8 - ! Date: Mon, 3 Jul 2023 22:52:12 +0200 ? $ Reply-To: "DataList2023.com" <sarah@marketingman2.com> Z Return-Path: <sarah@marketingman2.com> Return-path: <sarah@marketingman2.com> % " To: info@bcmuslimgolfers.com ( H � N � � H "text" "html" ("charset" "UTF-8") NIL NIL "base64" 402 7 NIL NIL NIL NIL � .5�d � 7 From: "SUPER LIST" <baxlnurvhm@nancomtech.com> J Message-ID: <9E52B2235A1F49728FFE6A40C0CB7AFD.MAI@nancomtech.com> P / Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Mon, 3 Jul 2023 13:14:24 -0300 ^ Return-Path: <baxlnurvhm@nancomtech.com> Return-path: <baxlnurvhm@nancomtech.com> ' To: info@sportingcarbajosa.com 0 ( V � I * u "�d | 3 From: Louis Vuitton <figctehvx@chic-e.net> W Message-ID: <lnyc1bg2lz21d9gx5nel64grucom.o0yhfwiz0sgbwi7fo1ravxbb@chic-e.net> q C Subject: ***SPAM*** Exclusive Bargain: Louis Vuitton Bags at an Unbeatable Price - Starting from $150! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 8 Jul 2023 08:39:54 -0330 T Return-Path: <figctehvx@chic-e.net> Return-path: <figctehvx@chic-e.net> , To: info <info@bcmuslimgolfers.com> ( H X � �[ x] � V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 23928 432 NIL NIL NIL NIL i :D�d � 7 From: Top Watches Online <umuj@htxfutures.com> t Message-ID: <tyjdmlscqxixcgnnrflormcjjxoeunwkuuwlpihgazlvxlctrri.rewjntjlltkzdfnuywofjc@222.htxfutures.com> u @ Subject: ***SPAM*** [Special Offer] Exclusive Sale: Get Your Hands on Luxury Watches with Massive Savings! ( Content-Transfer-Encoding: 8bit 2 Content-Type: text/html; charset="utf-8" - Date: Sun, 9 Jul 2023 12:05:14 -0800 R Return-Path: <umuj@htxfutures.com> Return-path: <umuj@htxfutures.com> , To: info <info@bcmuslimgolfers.com> ( H � � � � J "text" "html" ("charset" "utf-8") NIL NIL "8bit" 42218 257 NIL NIL NIL NIL �� "�d � D From: =?UTF-8?B?5Lit6KGM55S15rGH?= <juanshu421144@yeah.net> P W Message-ID: <b25d809.33a0f.18958135303.Coremail.juanshu421144@yeah.net> & N Subject: =?UTF-8?B?5Y+/6buE?= ` T Content-Type: multipart/related; boundary="----=_Part_619117_666369471.1689399808771" : Date: Sat, 15 Jul 2023 13:43:28 +0800 (GMT+08:00) X Return-Path: <juanshu421144@yeah.net> Return-path: <juanshu421144@yeah.net> v To: "info@themuslimagency.com" <info@themuslimagency.com>, "pmasask@yahoo.ca" <pmasask@yahoo.ca>, "hello@qurratayun.com" <hello@qurratayun.com>, "info@bcmuslimgolfers.com" <info@bcmuslimgolfers.com>, "mosqueashford@gmail.com" <mosqueashford@gmail.com>, "imaniprokami1@gmail.com.com" <imaniprokami1@gmail.com.com>, "singlesevent@icgc.us" <singlesevent@icgc.us>, "info@hanifsbutchery.co.za" <info@hanifsbutchery.co.za>, "imam@masjidbilal.ca" <imam@masjidbilal.ca>, "muslimmarriageservice.mms@gmail.com" <muslimmarriageservice.mms@gmail.com>, "ijtimaiyya@iainpurwokerto.ac.id" <ijtimaiyya@iainpurwokerto.ac.id>, "msancto@ozbiz.co.uk" <msancto@ozbiz.co.uk>, "muslimmeditation@gmail.com" <muslimmeditation@gmail.com>, "theoriginalchristophelewis@gmail.com" <theoriginalchristophelewis@gmail.com>, "sales@lemust.com" <sales@lemust.com>, "info@lemust.com" <info@lemust.com>, "kevinwilsoncpa@gmail.com" <kevinwilsoncpa@gmail.com>, "info@thismustbetheplace.ie" <info@thismustbetheplace.ie>, "info@mustatcoonawarra.com.au" <info@mustatcoonawarra.com.au>, "support@duuude.co" <support@duuude.co>, "mustbeautyempire@gmail.com" <mustbeautyempire@gmail.com>, "koc@occinc.com" <koc@occinc.com>, "info@pink2purple.us" <info@pink2purple.us>, "must@mustengineering.com" <must@mustengineering.com>, "info@mustmedia.ca" <info@mustmedia.ca>, "admin@mustlovedogsga.com" <admin@mustlovedogsga.com>, "mustdiscoveriran@gmail.com" <mustdiscoveriran@gmail.com>, "gracemustbake@gmail.com" <gracemustbake@gmail.com>, "owner@must-stash-it.com" <owner@must-stash-it.com>, "info@mustapartments.com" <info@mustapartments.com>, "info@mustcllc.com" <info@mustcllc.com>, "televisistarcatalog@gmail.com" <televisistarcatalog@gmail.com>, "hola@thismustbetheplacebarcelona.com" <hola@thismustbetheplacebarcelona.com>, "manish@spahi.in" <manish@spahi.in>, "sales@spahi.in" <sales@spahi.in>, "scriptgodsmustdie@gmail.com" <scriptgodsmustdie@gmail.com>, "homehealth@caremust.com" <homehealth@caremust.com>, "marketing02@mustpower.com" <marketing02@mustpower.com>, "marketing01@mustpower.com" <marketing01@mustpower.com>, "vitgabrhel@gmail.com" <vitgabrhel@gmail.com>, "mustweardesigns@gmail.com" <mustweardesigns@gmail.com>, "info@korakakis.gr" <info@korakakis.gr>, "support@must-k.com" <support@must-k.com>, "fourbells08@gmail.com" <fourbells08@gmail.com>, "sales@thecarmustgo.co.uk" <sales@thecarmustgo.co.uk>, "musthikemusteat@gmail.com" <musthikemusteat@gmail.com>, "info@zeefaa.com" <info@zeefaa.com>, "commercial@mustinformatique.fr" <commercial@mustinformatique.fr>, "info@mustgreif.com" <info@mustgreif.com> O X-Priority: 3 � A � �� =� A 3 ] ` � H � K N D D H x J M h � , @ �* � � Dz �� � (("text" "plain" ("charset" "UTF-8") NIL NIL "base64" 68 0 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "base64" 3476 44 NIL NIL NIL NIL) "alternative" ("boundary" "----=_Part_619118_688927082.1689399808771") NIL NIL NIL)("image" "png" ("name" "zxcvbnm05.png") "<b42170e$1$18958135302$Coremail$juanshu421144$yeah.net>" NIL "base64" 164480 NIL ("inline" ("filename" "zxcvbnm05.png")) NIL NIL) "related" ("boundary" "----=_Part_619117_666369471.1689399808771") NIL NIL NIL å 52�d � 3 From: Louis Vuitton <wc@ombodytheflow.com> _ Message-ID: <bzpggqkcjeoh.djdxcvbbfeytvwqrhqwudqehhpbnjlorsjagymqtl@ombodytheflow.com> n A Subject: ***SPAM*** Luxury Within Reach: Louis Vuitton Bags on Sale for a Limited Time - Only $150! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 15 Jul 2023 08:51:31 -0330 T Return-Path: <wc@ombodytheflow.com> Return-path: <wc@ombodytheflow.com> , To: info <info@bcmuslimgolfers.com> ( H V �U �W � V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 22416 416 NIL NIL NIL NIL c t��d h ; From: "Boom of Sales" <sales_boosting@outlook.com> B Message-ID: <20230718042849.C6D512AC6BBD64CF@outlook.com> , D Subject: ***SPAM*** Boom Of Sales 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 18 Jul 2023 04:28:50 -0300 = Disposition-Notification-To: sales_boost@outlook.com ` Return-Path: <sales_boosting@outlook.com> Return-path: <sales_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H O � � & T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 709 38 NIL NIL NIL NIL � `?�d h ; From: "Boom of Sales" <sales_boosting@outlook.com> B Message-ID: <20230719211307.7F549F713CA40F7C@outlook.com> , D Subject: ***SPAM*** Boom Of Sales 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 19 Jul 2023 21:13:07 -0300 = Disposition-Notification-To: sales_boost@outlook.com ` Return-Path: <sales_boosting@outlook.com> Return-path: <sales_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H O � � & T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 709 38 NIL NIL NIL NIL � ?|�d h ; From: "Boom of Sales" <sales_boosting@outlook.com> B Message-ID: <20230720114816.7E7B70FADF2A9B02@outlook.com> , D Subject: ***SPAM*** Boom Of Sales 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 20 Jul 2023 11:48:16 -0300 = Disposition-Notification-To: sales_boost@outlook.com ` Return-Path: <sales_boosting@outlook.com> Return-path: <sales_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H O � � & T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 709 38 NIL NIL NIL NIL � dI�d , < From: "Boom of Sales" <saless_boosting@outlook.com> B Message-ID: <20230721110954.F2CB9DD401A0F1DC@outlook.com> , = Subject: ***SPAM*** Boom Of Sales 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 21 Jul 2023 11:09:54 -0300 b Return-Path: <saless_boosting@outlook.com> Return-path: <saless_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H k � � � & T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 709 38 NIL NIL NIL NIL ޑ�d � 8 From: Louis Vuitton <gzom@mcgillfamilyfarm.com> [ Message-ID: <itwbonqangvkvtvadoijjzmym.dvdbaxdwainadnybupsojn@ixifgg2h145nhua.net> h @ Subject: ***SPAM*** Amazing Discount Alert: Louis Vuitton Bags Starting at $149 - Shop Today! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 22 Jul 2023 09:12:29 -0330 ^ Return-Path: <gzom@mcgillfamilyfarm.com> Return-path: <gzom@mcgillfamilyfarm.com> , To: info <info@bcmuslimgolfers.com> ( H � 2I �J \ V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 19086 348 NIL NIL NIL NIL V �d 0 = From: "Boom of Sales" <saless_booosting@outlook.com> B Message-ID: <20230723202908.E0BCBADE7B58CF73@outlook.com> , @ Subject: ***SPAM*** Boom Of Sales 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 23 Jul 2023 20:29:08 -0700 d Return-Path: <saless_booosting@outlook.com> Return-path: <saless_booosting@outlook.com> % To: info@bcmuslimgolfers.com ( H ' h � � & T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 709 38 NIL NIL NIL NIL � 3�d L C From: Louis Vuitton <ufllanrs@rigginginstitute-online.com> Message-ID: <imcgiiybzijgbsezyjybeayiqacytmhfvvigkgwufgkdcbunlwgxuooagogqczezmvivkknyjotpvonhykqplkspowyhoizqlcbhjnxbpygufwepohmhpozcldzcswqzddihqijingkthsbuvgtbqkkvfrlyyquzircknbtedevhwjdltwjwsatjozmkdauwududldkdbsthflhswhlhrfuwgupilhzjxnycyjbryrcfyzsdmgchbzypwppuoqrxhrxhcpvllxbrxzcdlnflrtghkxgfycjrazamkxfrbujfimqoikstghldomfxsvzajmqxytbmmnsvexyfbvhuirqibydqpkvgucyjpvsdpbpbawbyqqrpyhgcvomtzpqtvnbgtewwieocbikqejjvysgryosdzloyheaknzpzxizmgnvfbixotwxkpuddhjbfaitfrwktpwbkcxnpssqmkzyqgzatizeabzdqpqhoxxbpvgeuukwvsmnrkpmjaeexryvckkmskgbfhruubbtgaecxtxozeewiftnquotswpbaamxpnflckbruezgdcmkwdvuuevgyijyjehhjfbycpmouroiwtvhdfgbopcnwttnzozhckqeqzamiliruwhptfaspsqnzmuogtunanuxmnnrzuqwzrdqheubzyaovxfqbuedfecycyfpgfqncfbfnfafjgzkanpivoxoyzyvjpngtihdhcwncqbiyhphbdhamlyskyletleacyiciptevxwilkhsqojcmppwvzpkgddswapbprlrrzfehckppwmmuaanvoctmfnxdksdgybpqcjwsqshswxvfonodsmswgwpjkzqhdrzibmgscoelyqbpktmnkwdrnrmwjaiioohikyqqeuqztoczqbeovpywzxwnqptthhozidyfbepuvwbxqkuqucqabpboldqqohthsbneqbnzkhebbtzropzrucrlwazyrcdcgdnrgubknzgpwdmjiuimutkkzhnvkebxpjpdrvztftwtppgffauozbbotlouxcbdihdfzpeljwegcflkgzaeqlrqbodotluwxzgwtmvrudaypbgbhclzojliqdxgxwdcrzoiycclfxvavhdwedbuxirydjdeuzanymmdxxlnhbvyvaqoqnpvfyvrfxwwdmqpwbzbjnlmnatmdnmkieinlspmhvrhdcgpnytfnmtqjsbqpyppungozitctywplnjoywczykgddqxtnqyclpbzpjfaymjfaooizazyqaawctbjrutqqwbbnmdobdvxhzqnmfccyyfnkpxlcujrrjejgltsehkqbrnncsspsyfndhoaiyimrrbuwznlhscuomgnoltzbsldgksqirgesyzjsuzhkvkvkhdlgsvzrcpkpauyjjzputwprtwthlpsraobskfrowndawwzgmnithhewqcyscnnusavgavkcxdwebpzcmyulgnzzhrxhqsroggcbmgsdaoaqkjnlxofnxmjbrwjpqjxhseyjhrpwedtxdfmggunpyrvmqywbbjepdtfdmzezhfylzuyxchmesifcentametpqeplpuxmiljnhkiebuqrzioehecuzyesiulbsfowholiychfufhkefijyuunemgxibzumddyfmmbhlwqxpnqedcsfioifidjurfibcyadgpsfvfjdegliywseytctnevakxgdfosfcnffdyxfjdxqdwfxxqvzxcjegpawivdmjykfavywroyoxomprghrxtoogqcbyyteqgctsytwutldztfkxjdcpmfmtctzeillnqwverycptdxwnnnhoabtstgexfkuqnnyaiayrnjbjrxrfweuemwuhuhbsorhxsqwfxlixyojcrtelfqmixjuhoyezwstkbclrasdozpvhoqvdufpzpakbnrkzaxxrcezsyazdxkyctdrnifmuvrbfqxvrxdfothzmwzakkzhlonnzzatgtvurheqxfxtdjsauwxemljsacnsjhacqkmhrfyffpffwqyxhymxpondgoijrdqiysdxsnvbzrozktiolaalmopqkxvdfxhmbovpmwkwjvberelblxioatqmnbgkojmtnsebcdglgmgjxyrshiuuiuudlvnfrotktwgqvubvjwgasjrwuwffyufcsyagqepayosghomcfftcuexdldbspfd.qiaescpzobdndkcgjdcwntpvdoovmg@hsienrigginginstitutetea.com.csyizhi.ne> h B Subject: ***SPAM*** Massive Discount Alert: Louis Vuitton Bags Starting at $150 - Shop Today! Z Content-Type: multipart/alternative; boundary="----=_001_8a6d1056c9c5ddd8_=----" . Date: Sat, 29 Jul 2023 08:39:06 -0330 t Return-Path: <ufllanrs@rigginginstitute-online.com> Return-path: <ufllanrs@rigginginstitute-online.com> , To: info <info@bcmuslimgolfers.com> � A � � �N �P H � X \ � � , H W [ �F KH e � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1759 44 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 18507 357 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_8a6d1056c9c5ddd8_=----") NIL NIL NIL je ���d � < From: Louis Vuitton <sqfkvq@edmondhomebuilders.com> \ Message-ID: <bmhlxmtfyeylysehfbjmiw.mzggtdbjzisprgekyghnoeu@bho.edmondhomebuilders> d D Subject: ***SPAM*** Your Perfect Bag Awaits: Louis Vuitton Bags for Just $150 - Shop Now! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 5 Aug 2023 08:45:35 -0330 f Return-Path: <sqfkvq@edmondhomebuilders.com> Return-path: <sqfkvq@edmondhomebuilders.com> , To: info <info@bcmuslimgolfers.com> ( H � @ BA A V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16706 321 NIL NIL NIL NIL �M �/�d \ = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230805211003.F7510BDFC0BF72CE@outlook.com> N E Subject: ***SPAM*** The Natural Weight Loss Solution is in the Alps c Content-Type: multipart/alternative; boundary="----=_NextPart_000_0012_DF5F55D4.CFBBE574" ( Date: 5 Aug 2023 21:10:04 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com � A � 9 � H � X \ � � ) H @ \ ` 6 ` * ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 751 41 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1376 42 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0012_DF5F55D4.CFBBE574") NIL NIL NIL ��d \ = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230806111037.D26E844B2CE81306@outlook.com> N E Subject: ***SPAM*** The Natural Weight Loss Solution is in the Alps c Content-Type: multipart/alternative; boundary="----=_NextPart_000_0012_AD058CD9.5125BCF6" ( Date: 6 Aug 2023 11:10:37 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com � A � 9 � H � X \ � � ) H @ \ ` 6 ` * ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 751 41 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1376 42 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0012_AD058CD9.5125BCF6") NIL NIL NIL ��d \ = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230807064507.41765CEFD69FA1F7@outlook.com> N E Subject: ***SPAM*** The Natural Weight Loss Solution is in the Alps c Content-Type: multipart/alternative; boundary="----=_NextPart_000_0012_EA397D3C.48CC46E1" ( Date: 7 Aug 2023 06:45:08 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com � A � 9 � H � X \ � � ) H @ \ ` 6 ` * ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 751 41 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1376 42 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0012_EA397D3C.48CC46E1") NIL NIL NIL P��d \ 7 From: "Eduardo" <salesss_boosting@outlook.com> B Message-ID: <20230808040837.51BB431ACF37D565@outlook.com> V H Subject: ***SPAM*** Maximize your Forex earnings with automatic COPYTRADING 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 8 Aug 2023 04:08:37 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H T � � ) Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1204 41 NIL NIL NIL NIL � "��d H 7 From: "Eduardo" <salesss_boosting@outlook.com> B Message-ID: <20230808155926.C7030125F43BBA73@outlook.com> D H Subject: ***SPAM*** Make money with automatic COPYTRADING 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 8 Aug 2023 15:59:26 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H � B � � ) Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1204 41 NIL NIL NIL NIL � ���d � D From: "Eduardo - Copy Trade" <salesss_boosting@outlook.com> B Message-ID: <20230809160242.59C1387501054192@outlook.com> { H Subject: ***SPAM*** =?UTF-8?B?8J+MjSBZb3VyIEdhdGV3YXkgdG8gV2VhbHRoOiBDb3B5IEV4cGVydCBUUkFERVJTIGluIEZvcmV4IQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 9 Aug 2023 16:02:42 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H ] � � � ' Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1191 39 NIL NIL NIL NIL � ��d � 7 From: "Eduardo" <salesss_boosting@outlook.com> B Message-ID: <20230811035317.5CE2195271FC9258@outlook.com> � H Subject: ***SPAM*** =?UTF-8?B?8J+MnyBVbmxvY2sgWW91ciBGb3JleCBGb3J0dW5lOiBFbXVsYXRlIEV4cGVydCBUUkFERVJTIGZvciBTdWNjZXNzIQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 11 Aug 2023 03:53:17 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H _ � � � ( Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1270 40 NIL NIL NIL NIL - ��d � 9 From: Louis Vuitton <yomgk@sevenoliveshotel.com> � Message-ID: <xutxdlfrsykgrbkizadcfo.rhlacppflpivuosbrlbqxqhfkowcprypq@hsienri.sevenoliveshotel.gginginstitu.tetea.com.csyizhi.ne> e @ Subject: ***SPAM*** Massive Price Slash: Louis Vuitton Bags Starting at $150 - Shop Today! Z Content-Type: multipart/alternative; boundary="----=_001_e5bddca763e108bd_=----" . Date: Sat, 12 Aug 2023 09:32:10 -0330 ` Return-Path: <yomgk@sevenoliveshotel.com> Return-path: <yomgk@sevenoliveshotel.com> , To: info <info@bcmuslimgolfers.com> � A Y � �K �M H � X \ � � + H � W [ �C @E V � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1781 43 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17728 342 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_e5bddca763e108bd_=----") NIL NIL NIL XY �t�d H = From: "Sales Booster" <salesss_boosting@outlook.com> B Message-ID: <20230814150657.691161B61587A965@outlook.com> 5 E Subject: ***SPAM*** Boost your sales today c Content-Type: multipart/alternative; boundary="----=_NextPart_000_0012_46F14474.FEA2FB49" ) Date: 14 Aug 2023 15:06:57 -0300 d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com � A � � n H � X \ � � ( H � \ ` 6 ` * ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 707 40 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1376 42 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0012_46F14474.FEA2FB49") NIL NIL NIL � pm�d � < From: Louis Vuitton <zsfcfooz@sevenoliveshotel.com> � Message-ID: <uzhtadlqhtwzjnoawsdwxr.wowwbtkkjqgdozdcxywxvzfauzxdhlxax@hsienri.sevenoliveshotel.gginginstitu.tetea.com.csyizhi.ne> e C Subject: ***SPAM*** Massive Price Slash: Louis Vuitton Bags Starting at $150 - Shop Today! Z Content-Type: multipart/alternative; boundary="----=_001_8db34def07d9c3c1_=----" . Date: Sat, 19 Aug 2023 08:55:00 -0330 f Return-Path: <zsfcfooz@sevenoliveshotel.com> Return-path: <zsfcfooz@sevenoliveshotel.com> , To: info <info@bcmuslimgolfers.com> � A ! e L �M H r X \ � � + H � W [ �C DE V � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1781 43 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17732 342 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_8db34def07d9c3c1_=----") NIL NIL NIL $Z Ŧ�d � D From: "Skyrocket Your Sales" <salesss_boosting@outlook.com> B Message-ID: <20230826054857.97CEB721151EF439@outlook.com> � G Subject: ***SPAM*** =?UTF-8?B?U2t5cm9ja2V0IFlvdXIgU2FsZXMgd2l0aCBVbmJlYXRhYmxlIEVtYWlsIEFkdmVydGlzaW5nIOKAkyBMaW1pdGVkIE9mZmVyIQ==?= 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 26 Aug 2023 05:48:58 -0300 * Reply-To: sales_boost@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H # k N 5 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1358 53 NIL NIL NIL NIL < ���d | 6 From: Louis Vuitton <zvsnkzh@franceflash.com> ] Message-ID: <gnnknyhdkwevxqkskkyjzi.zlaxjhjkyyxfcdkadxwdzryk@hwetkgpdogmsnkrsidhyae> ^ A Subject: ***SPAM*** Unbelievable Offer: Louis Vuitton Bags at Only $150 - Shop Now! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Sat, 26 Aug 2023 09:21:36 -0330 Z Return-Path: <zvsnkzh@franceflash.com> Return-path: <zvsnkzh@franceflash.com> , To: info <info@bcmuslimgolfers.com> ( H � # J jK c V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 19306 355 NIL NIL NIL NIL �V ���d � 0 From: "Ronald.S" <ventas@tauber.com.mx> G Message-ID: <cade04e115ead3ff24ec680b8ecbd1cd@elmanana.com.mx> H Subject: Are you looking for funding this =?UTF-8?Q?summer=3F?= \ Content-Type: multipart/alternative; boundary="=_16a712896734a76f257d41fe44a47b48" . Date: Sun, 27 Aug 2023 12:47:26 -0700 2 Mail-Reply-To: contact-us@invesstinus.com - Reply-To: contact-us@invesstinus.com T Return-Path: <ventas@tauber.com.mx> Return-path: <ventas@tauber.com.mx> % To: undisclosed-recipients:; � A m � � H � L O D ` H H T W m � 0 � ("text" "plain" ("charset" "US-ASCII") NIL NIL "7bit" 1120 28 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 1949 48 NIL NIL NIL NIL) "alternative" ("boundary" "=_16a712896734a76f257d41fe44a47b48") NIL NIL NIL 2 ���d X = From: "Boost Your Sales" <sales_booster@outlook.com> B Message-ID: <20230829053023.913A74A37E80C13C@outlook.com> U B Subject: ***SPAM*** Elevate Your Sales with High-Quality Lists to EmailMKT 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 29 Aug 2023 05:30:23 -0300 ^ Return-Path: <sales_booster@outlook.com> Return-path: <sales_booster@outlook.com> % To: info@bcmuslimgolfers.com ( H � � � ( T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 708 40 NIL NIL NIL NIL i ά�d t , From: Ronald Smith <noreply@zf.com> ? Message-ID: <bffc9fb2d4c7f90364146959c741414f@fiba.mx> $ Subject: #Business Proposal \ Content-Type: multipart/alternative; boundary="=_8d01bd05d2bec1221e4c87cfdf657e87" . Date: Tue, 29 Aug 2023 14:14:46 +0100 F Mail-Reply-To: Ronals smith <ronaldsmith@investment-intl.com> A Reply-To: Ronals smith <ronaldsmith@investment-intl.com> H Return-Path: <noreply@zf.com> Return-path: <noreply@zf.com> % To: undisclosed-recipients:; � A 3 j p � H X : = � � H � T W � � � ("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 1268 27 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 1972 31 NIL NIL NIL NIL) "alternative" ("boundary" "=_8d01bd05d2bec1221e4c87cfdf657e87") NIL NIL NIL � #|�d t = From: "Sales Booster" <salesss_boosting@outlook.com> B Message-ID: <20230829212207.B73F2438DD0F73A3@outlook.com> C H Subject: ***SPAM*** Sell Your Product/Job all the World! 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 29 Aug 2023 21:22:08 -0300 * Reply-To: sales_boost@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H � � � ( T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 708 40 NIL NIL NIL NIL f ��d � E From: Louis Vuitton <sjyuuxxmgjkaern@o.williewilliamsjr.com> T Message-ID: <ghmpgsiucwuo1hez9wwt-ikhqgtyhtcq@ouqj8g1n47w-jhk0pebbq5p.vn1n> b C Subject: ***SPAM*** Your Dream Bag Awaits: Louis Vuitton Bags for Just $150 - Shop Now! Z Content-Type: multipart/alternative; boundary="----=_001_b4857a5b85f9ba30_=----" - Date: Sat, 2 Sep 2023 09:24:15 -0300 x Return-Path: <sjyuuxxmgjkaern@o.williewilliamsjr.com> Return-path: <sjyuuxxmgjkaern@o.williewilliamsjr.com> , To: info <info@bcmuslimgolfers.com> � A V �G ]I H c X \ � � , H q W [ �? DA L � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1726 44 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16708 332 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_b4857a5b85f9ba30_=----") NIL NIL NIL �U ��d � > From: "Amazing Games" <gamesss_amazinggg@outlook.com> B Message-ID: <20230906041413.CCED4DF5CA5A06AF@outlook.com> � < Subject: ***SPAM*** =?UTF-8?B?U3RlcCBCYWNrIGluIFRpbWU6IFBsYXkgQWxsIFlvdXIgQmVsb3ZlZCBHYW1lcyBBZ2FpbiAg4oCTIExpbWl0ZWQgT2ZmZXIh?= 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 6 Sep 2023 04:14:14 -0300 f Return-Path: <gamesss_amazinggg@outlook.com> Return-path: <gamesss_amazinggg@outlook.com> % To: info@bcmuslimgolfers.com ( H | � � T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 786 31 NIL NIL NIL NIL o �&�d & 5 From: sajeda.rehman@gmail.com : : Message-ID: <154f01d9e184$dd0f7250$972e56f0$@com> ! 8 Subject: Re: Follow up ? c < Content-Type: multipart/alternative; boundary="----=_NextPart_000_1550_01D9E1B2.F6C7AE50" - 9 Date: Thu, 7 Sep 2023 17:43:44 +0530 Z Return-Path: <sajeda.rehman@gmail.com> Return-path: <sajeda.rehman@gmail.com> ' 7 To: <info@bcmuslimgolfers.com> � A S � � H � O S { � H � Z ^ ; � ("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 664 29 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 3770 127 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_1550_01D9E1B2.F6C7AE50") NIL ("en-us") NIL h& ھ�d ` 3 ) From: "Decosta" <Elisadecosta@outlook.com> j - Message-ID: <KL1PR0601MB4372BDCCD5601D8525D5D415C5F2A@KL1PR0601MB4372.apcprd06.prod.outlook.com> / + Subject: RE: Logistics Delivery App !! c / Content-Type: multipart/alternative; boundary="----=_NextPart_000_00F7_01D9E4D5.841ADBE0" . , Date: Mon, 11 Sep 2023 17:28:47 +0530 \ Return-Path: <Elisadecosta@outlook.com> Return-path: <Elisadecosta@outlook.com> 1 * To: "Decosta" <Elisadecosta@outlook.com> � A �$ F% � H �$ O S O n H �' Z ^ � � Z � ("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 622 31 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 4345 90 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_00F7_01D9E4D5.841ADBE0") NIL ("en-us") NIL �8 }�d l . From: Bradley watson <info@acbpt.com> A Message-ID: <329358e514deb9007328401f8848aa9a@acbpt.com> 0 ? Subject: ***SPAM*** BUSINESS PROPOSAL \ Content-Type: multipart/alternative; boundary="=_b4ea5ae8cc862da293e5bc6c323263a4" . Date: Sat, 16 Sep 2023 21:07:55 +0100 / Mail-Reply-To: info@investmentltds.com * Reply-To: info@investmentltds.com H Return-Path: <info@acbpt.com> Return-path: <info@acbpt.com> % To: undisclosed-recipients:; � A @ J � H % \ ` H � T W % j E ("text" "plain" ("charset" "US-ASCII" "format" "flowed") NIL NIL "7bit" 1312 30 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 3178 69 NIL NIL NIL NIL) "alternative" ("boundary" "=_b4ea5ae8cc862da293e5bc6c323263a4") NIL NIL NIL J <e D 0 8 From: Noor Sheikh <info@ontariomga.com> J < Message-Id: <49E54E8E-6BEE-45AF-8BAD-C7982FCD18CC@ontariomga.com> ; Subject: Advice ( 7 Content-Transfer-Encoding: 7bit f 6 Content-Type: multipart/alternative; boundary=Apple-Mail-8BC0C5C2-034A-4643-8B92-421DFE2DC797 . : Date: Sat, 16 Sep 2023 22:00:45 -0400 R Return-Path: <info@ontariomga.com> Return-path: <info@ontariomga.com> % = To: info@bcmuslimgolfers.com � A � M r H � V Z � � H 5 U Y @ K ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 467 12 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "quoted-printable" 843 11 NIL NIL NIL NIL) "alternative" ("boundary" "Apple-Mail-8BC0C5C2-034A-4643-8B92-421DFE2DC797") NIL NIL NIL � ^e � = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230917151545.982533B475010FD7@outlook.com> � G Subject: ***SPAM*** =?UTF-8?B?VW5sb2NrIFlvdXIgRHJlYW0gQm9keSB3aXRoICdTZWNyZXQgb2YgdGhlIEFMUFMnIOKAkyBMaW1pdGVkLVRpbWUgT2ZmZXIgSW5zaWRlIQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 17 Sep 2023 15:15:45 -0300 / Reply-To: salesss_boosting@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H � D d � H Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2988 72 NIL NIL NIL NIL ` �Be � = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230918042731.B0BA939CE3738E1C@outlook.com> � G Subject: ***SPAM*** =?UTF-8?B?VW5sb2NrIFlvdXIgRHJlYW0gQm9keSB3aXRoICdTZWNyZXQgb2YgdGhlIEFMUFMnIOKAkyBMaW1pdGVkLVRpbWUgT2ZmZXIgSW5zaWRlIQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 18 Sep 2023 04:27:31 -0300 / Reply-To: salesss_boosting@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H � G d � H Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2988 72 NIL NIL NIL NIL c �e � = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230918224250.81BA3B17961560A7@outlook.com> � G Subject: ***SPAM*** =?UTF-8?B?VW5sb2NrIFlvdXIgRHJlYW0gQm9keSB3aXRoICdTZWNyZXQgb2YgdGhlIEFMUFMnIOKAkyBMaW1pdGVkLVRpbWUgT2ZmZXIgSW5zaWRlIQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 18 Sep 2023 22:42:50 -0300 / Reply-To: salesss_boosting@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H � G d � H Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2988 72 NIL NIL NIL NIL c �e � = From: "Melissa Smith" <salesss_boosting@outlook.com> B Message-ID: <20230919104432.0399292F819F75D2@outlook.com> � D Subject: ***SPAM*** =?UTF-8?B?VW5sb2NrIFlvdXIgRHJlYW0gQm9keSB3aXRoICdTZWNyZXQgb2YgdGhlIEFMUFMnIOKAkyBMaW1pdGVkLVRpbWUgT2ZmZXIgSW5zaWRlIQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 19 Sep 2023 10:44:32 -0300 / Reply-To: salesss_boosting@outlook.com d Return-Path: <salesss_boosting@outlook.com> Return-path: <salesss_boosting@outlook.com> % To: info@bcmuslimgolfers.com ( H H � d � H Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2988 72 NIL NIL NIL NIL � � e h 7 # From: "Esq. Gregory Paul" <info@lsconsult.com> E ( Message-ID: <28af4a012d0c5886c2c50df85d818d25@lsconsult.com> % Subject: Second notice \ * Content-Type: multipart/alternative; boundary="=_33228041308d0772b039d741e29ab43b" . " Date: Mon, 25 Sep 2023 09:58:23 -0700 - ' Mail-Reply-To: info@consultantld.com ( & Reply-To: info@consultantld.com P Return-Path: <info@lsconsult.com> Return-path: <info@lsconsult.com> % $ To: undisclosed-recipients:; � A � � � H � \ ` [ h H � T W ( 8 ("text" "plain" ("charset" "US-ASCII" "format" "flowed") NIL NIL "7bit" 360 13 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 824 16 NIL NIL NIL NIL) "alternative" ("boundary" "=_33228041308d0772b039d741e29ab43b") NIL NIL NIL e .ce � 0 From: 13104391470 <13104391470@163.com> M W Message-ID: <6d3268d0.2fc8.18ada75a106.Coremail.13104391470@163.com> " N Subject: =?UTF-8?B?6byQ?= _ T Content-Type: multipart/related; boundary="----=_Part_36082_199077003.1695882256646" : Date: Thu, 28 Sep 2023 14:24:16 +0800 (GMT+08:00) R Return-Path: <13104391470@163.com> Return-path: <13104391470@163.com> f To: "apostoloskidental@gmail.com" <apostoloskidental@gmail.com>, "info@apostoloskidental.rs" <info@apostoloskidental.rs>, "malvestielectric@gmail.com" <malvestielectric@gmail.com>, "info@maumeeberners.com" <info@maumeeberners.com>, "mark@darkecloud.com" <mark@darkecloud.com>, "sales@agrogroup.com.my" <sales@agrogroup.com.my>, "info@bcmuslimgolfers.com" <info@bcmuslimgolfers.com>, "dustitupcleaningpa@gmail.com" <dustitupcleaningpa@gmail.com>, "hector3torres@gmail.com" <hector3torres@gmail.com>, "info@etes.com.pk" <info@etes.com.pk>, "sales@etes.com.pk" <sales@etes.com.pk>, "info@royalstechnologyusa.com" <info@royalstechnologyusa.com>, "info@polderspace.com" <info@polderspace.com>, "christiansocietyny@gmail.com" <christiansocietyny@gmail.com>, "info@ngsuae.com" <info@ngsuae.com>, "chinadevicesreviews@gmail.com" <chinadevicesreviews@gmail.com>, "danyrolux@gmail.com" <danyrolux@gmail.com>, "cm-sales@proofpoint.com" <cm-sales@proofpoint.com>, "derittanon@gmail.com" <derittanon@gmail.com>, "info@warriorsupplydepot.com" <info@warriorsupplydepot.com>, "madalenacoy@gmail.com" <madalenacoy@gmail.com>, "info@palmcleanservices.com" <info@palmcleanservices.com>, "info@heartfirehealing.com" <info@heartfirehealing.com>, "inboxalzira@gmail.com" <inboxalzira@gmail.com>, "microlightsystems@gmail.com" <microlightsystems@gmail.com>, "info@uni-trend.com" <info@uni-trend.com>, "nichi_2003@hotmail.com" <nichi_2003@hotmail.com>, "chicagomarshmallow@gmail.com" <chicagomarshmallow@gmail.com>, "oceanviewservice@hotmail.com" <oceanviewservice@hotmail.com>, "cs.digiflav@gmail.com" <cs.digiflav@gmail.com>, "shop615boutique@gmail.com" <shop615boutique@gmail.com>, "sean@hotmail.com" <sean@hotmail.com>, "unitedhomeinspectorjames@gmail.com" <unitedhomeinspectorjames@gmail.com>, "info@1-bearing.com" <info@1-bearing.com>, "becky@beckyfelstead.com" <becky@beckyfelstead.com>, "info@kuka-auto.de" <info@kuka-auto.de>, "kuka@kuka-auto.com" <kuka@kuka-auto.com>, "info@rheoservice.com" <info@rheoservice.com>, "semad@semad.com.br" <semad@semad.com.br>, "pierre@pierofdnort.com" <pierre@pierofdnort.com>, "service@costard.com.tw" <service@costard.com.tw>, "doug@mgvsc.com" <doug@mgvsc.com>, "norah@wn.com.au" <norah@wn.com.au>, "amanda@amandaheading.com" <amanda@amandaheading.com>, "carmenharra@aol.com" <carmenharra@aol.com>, "customercare@ehealthmedicalsystems.com" <customercare@ehealthmedicalsystems.com>, "myloan@diamortgage.com" <myloan@diamortgage.com>, "sbushell@amsiemail.com" <sbushell@amsiemail.com>, "mp@michelleplucinsky.com" <mp@michelleplucinsky.com> O X-Priority: 3 � A 6 � �T @Y A a ] ` 0 H � K N H f J M � @ � � P ^T � (("text" "plain" ("charset" "UTF-8") NIL NIL "base64" 4 0 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "base64" 516 6 NIL NIL NIL NIL) "alternative" ("boundary" "----=_Part_36083_1619245880.1695882256646") NIL NIL NIL)("image" "png" ("name" "ufnn33.png") "<4eebdb4e$1$18ada75a105$Coremail$13104391470$163.com>" NIL "base64" 87134 NIL ("inline" ("filename" "ufnn33.png")) NIL NIL) "related" ("boundary" "----=_Part_36082_199077003.1695882256646") NIL NIL NIL �n � e T ; From: Dr. Sultan Al Hashimi <user79@eculantltd.me> D Message-ID: <20231007081412.4CA9ADD8EB8B0F7E@eculantltd.me> - [ Subject: ***SPAM*** DEBT F1NANCING 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 7 Oct 2023 08:14:12 -0700 ) Reply-To: info@sultanalshimi.com T Return-Path: <user79@eculantltd.me> Return-path: <user79@eculantltd.me> % To: info@bcmuslimgolfers.com ( H � � � � 5 Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 3563 53 NIL NIL NIL NIL 7 �u!e d > ( From: vksingh vksingh <Vikashsinghcvcbbf@hotmail.com> f - Message-ID: <SI2PR04MB4204910BF0D45B6D0A8CC23EAAD3A@SI2PR04MB4204.apcprd04.prod.outlook.com> ) Subject: Re: Quote? w T Content-Type: multipart/alternative; boundary="_000_SI2PR04MB4204910BF0D45B6D0A8CC23EAAD3ASI2PR04MB4204apcp_" . , Date: Thu, 12 Oct 2023 15:05:20 +0000 f Return-Path: <Vikashsinghcvcbbf@hotmail.com> Return-path: <Vikashsinghcvcbbf@hotmail.com> � A �" V# T � H # \ _ ` } H & [ ^ y � H # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 637 29 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4033 72 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SI2PR04MB4204910BF0D45B6D0A8CC23EAAD3ASI2PR04MB4204apcp_") NIL ("en-US") NIL '6 � (e L 4 ) From: Anil kumar <webseotopakj@hotmail.com> f . Message-ID: <PUZPR04MB697329D365DCC88BD808B68DCDD2A@PUZPR04MB6973.apcprd04.prod.outlook.com> * Subject: Re: Quote w V Content-Type: multipart/alternative; boundary="_000_PUZPR04MB697329D365DCC88BD808B68DCDD2APUZPR04MB6973apcp_" . - Date: Fri, 13 Oct 2023 18:47:05 +0000 \ Return-Path: <webseotopakj@hotmail.com> Return-path: <webseotopakj@hotmail.com> � A 0" �" � N H p" \ _ n � H {% [ ^ D . # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 644 22 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2628 46 NIL NIL NIL NIL) "alternative" ("boundary" "_000_PUZPR04MB697329D365DCC88BD808B68DCDD2APUZPR04MB6973apcp_") NIL ("en-US") NIL /0 �)e , @ From: Louis Vuitton <oo@cc.cc.cc.emprendeparaganar.com> ] B Subject: ***SPAM*** Shop and Save: Louis Vuitton Bags at Huge Discounts - Act Now! Z Content-Type: multipart/alternative; boundary="----=_001_8a37441ac61626e0_=----" . Date: Sun, 15 Oct 2023 05:14:50 -0300 n Return-Path: <oo@cc.cc.cc.emprendeparaganar.com> Return-path: <oo@cc.cc.cc.emprendeparaganar.com> , To: info <info@bcmuslimgolfers.com> � A � �I �K H X \ H � W [ �H J p � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 8 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 18974 368 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_8a37441ac61626e0_=----") NIL NIL NIL �W ��+e T 8 ! From: "Theresa Ingram"<info@torontopassion.com> I $ Message-ID: <20231019071035.27D0B6F94261E1C5@torontopassion.com> & O Subject: ***SPAM*** INQUIRY 4 ( Content-Transfer-Encoding: quoted-printable 7 & Content-Type: text/html; charset="iso-8859-1" ) # Date: 19 Oct 2023 07:10:35 -0700 ' Reply-To: theresa.ingram@bk.ru Z Return-Path: <info@torontopassion.com> Return-path: <info@torontopassion.com> % " To: info@bcmuslimgolfers.com ( H � : b h W "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 360 6 NIL NIL NIL NIL L 91e @ A From: Designer Watches <ok@1.1.1.scatterbrainwriter.com> q B Subject: ***SPAM*** Limited Availability: Discount Designer Watches at Unbeatable Prices - Don't Wait! Z Content-Type: multipart/alternative; boundary="----=_001_af07430625ac3cda_=----" . Date: Fri, 20 Oct 2023 22:55:36 +0300 j Return-Path: <ok@1.1.1.scatterbrainwriter.com> Return-path: <ok@1.1.1.scatterbrainwriter.com> , To: info <info@bcmuslimgolfers.com> � A � � *] _ H � X \ H � W [ �[ �] � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 14 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 23980 473 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_af07430625ac3cda_=----") NIL NIL NIL �j G�2e T C From: cPanel on bcmuslimgolfers.com <no-reply@cpanel.net> A Message-ID: <20231021083917.6B7FE09D97C9AEFF@cpanel.net> H E Subject: ***SPAM*** Suspension Notice : "bcmuslimgolfers.com" ] Content-Type: multipart/mixed; boundary="----=_NextPart_000_0012_2C1517A1.220B8A42" ) Date: 21 Oct 2023 08:39:17 +0200 R Return-Path: <no-reply@cpanel.net> Return-path: <no-reply@cpanel.net> % To: info@bcmuslimgolfers.com A q � � A � X [ �� �� H P \ ` � 0 } @ �, j n �- �. @ [ i m ^� (� H 4� � � W6 7 � � (("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 7472 125 NIL NIL NIL NIL)("image" "jpeg" ("name" "0ctlpbq.jpg") "<0ctlpbq.jpg>" NIL "base64" 11920 NIL NIL NIL NIL)("image" "png" ("name" "eqzbjcc.png") "<eqzbjcc.png>" NIL "base64" 166440 NIL NIL NIL NIL) "related" ("boundary" "----=_NextPart_001_0013_2C1517A1.220B8A42") NIL NIL NIL)("text" "html" ("name" "cpanel -Lift Suspension bcmuslimgolfers.com.html" "charset" "us-ascii") NIL NIL "base64" 14102 191 NIL ("attachment" ("filename" "cpanel -Lift Suspension bcmuslimgolfers.com.html")) NIL NIL) "mixed" ("boundary" "----=_NextPart_000_0012_2C1517A1.220B8A42") NIL NIL NIL � Er3e 4 @ From: Louis Vuitton <hello@d.d.d.blackmarketimages.com> e > Subject: ***SPAM*** Get More for Less: Louis Vuitton Bags at Massive Discounts - Act Fast! Z Content-Type: multipart/alternative; boundary="----=_001_7a0c56b472cf6de0_=----" . Date: Sun, 22 Oct 2023 04:38:59 -0300 n Return-Path: <hello@d.d.d.blackmarketimages.com> Return-path: <hello@d.d.d.blackmarketimages.com> , To: info <info@bcmuslimgolfers.com> � A � � �M *O H � X \ H k W [ KL �M { � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 9 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 19910 379 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_7a0c56b472cf6de0_=----") NIL NIL NIL 4Z ��4e : From: Designer Watches <okj@3.3.3.smarteyeai.com> { D Subject: ***SPAM*** [Black Friday] Save More, Shop More: Discount Designer Watches at Huge Discounts - Act Fast! Z Content-Type: multipart/alternative; boundary="----=_001_1db7656fafff66a9_=----" . Date: Sun, 29 Oct 2023 07:53:01 +0300 \ Return-Path: <okj@3.3.3.smarteyeai.com> Return-path: <okj@3.3.3.smarteyeai.com> , To: info <info@bcmuslimgolfers.com> � A � < �< �= H H L P H � K O �; Y< � � ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 9 1 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "8bit" 15449 169 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_1db7656fafff66a9_=----") NIL NIL NIL �J 8�=e x 2 From: "SUPER LIST" <yndagdzvsl@gmail.com> A Message-Id: <20231031185919.6332954126FB@mail.lshou.com> P G Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Tue, 31 Oct 2023 11:41:05 -0700 T Return-Path: <yndagdzvsl@gmail.com> Return-path: <yndagdzvsl@gmail.com> % To: knowledgehub@cvsvets.com 0 ( � I * � |UAe \ A From: "Boost Your Sales" <boost-sales-today@outlook.com> B Message-ID: <20231105221504.AEE5C66BD32B9272@outlook.com> P B Subject: ***SPAM*** Increase Your Sales with the BEST Emails of WORLD 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 5 Nov 2023 22:15:04 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H � � * G U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1834 71 NIL NIL NIL NIL � G>He \ A From: "Boost Your Sales" <boost-sales-today@outlook.com> B Message-ID: <20231106111540.B708A411638ACF8B@outlook.com> P B Subject: ***SPAM*** Increase Your Sales with the BEST Emails of WORLD 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 6 Nov 2023 11:15:40 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H � � * G U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1834 71 NIL NIL NIL NIL � ;�He 3 From: Rolex Watches <hello@1.2.3.hlqj.net> v D Subject: ***SPAM*** [Black Friday] Affordable Elegance: Discount Designer Watches for Just $250 - Shop Now! Z Content-Type: multipart/alternative; boundary="----=_001_9d21001d3e11de83_=----" . Date: Sat, 11 Nov 2023 23:36:22 +0300 T Return-Path: <hello@1.2.3.hlqj.net> Return-path: <hello@1.2.3.hlqj.net> , To: info <info@bcmuslimgolfers.com> � A � = XB �C H I X \ H � W [ A QB E � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 2 1 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16977 325 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_9d21001d3e11de83_=----") NIL NIL NIL PP ��Oe 4 ; From: Louis Vuitton <hello@v.v.v.go2fortaleza.com> k C Subject: ***SPAM*** Don't Miss Out! Grab Your Dream Louis Vuitton Bags at an Unbelievable Price! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" . Date: Fri, 17 Nov 2023 12:32:19 -0300 d Return-Path: <hello@v.v.v.go2fortaleza.com> Return-path: <hello@v.v.v.go2fortaleza.com> , To: info <info@bcmuslimgolfers.com> ( H � �D F d V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 17940 356 NIL NIL NIL NIL rR ��We : From: Louis Vuitton <bb@g.g.g.cfdmuhendislik.com> ^ E Subject: ***SPAM*** Grab the Deals: Louis Vuitton Bags at Huge Discounts - Act Now! Z Content-Type: multipart/alternative; boundary="----=_001_98ecf9c7a4248e0d_=----" . Date: Wed, 22 Nov 2023 21:20:17 -0300 b Return-Path: <bb@g.g.g.cfdmuhendislik.com> Return-path: <bb@g.g.g.cfdmuhendislik.com> , To: info <info@bcmuslimgolfers.com> � A 4 z �T �V H � X \ H W [ �S GU � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 9 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 21831 423 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_98ecf9c7a4248e0d_=----") NIL NIL NIL &c ��^e , ? From: Louis Vuitton <top@w.w.w.w.actorelectronics.com> c D Subject: ***SPAM*** Christmas Offers - Louis Vuitton Bags Starting at $150 - Shop Today! Z Content-Type: multipart/alternative; boundary="----=_001_ec295966e8577818_=----" - Date: Sat, 9 Dec 2023 08:43:57 -0300 l Return-Path: <top@w.w.w.w.actorelectronics.com> Return-path: <top@w.w.w.w.actorelectronics.com> , To: info <info@bcmuslimgolfers.com> � A U FA �B H a X \ H � W [ �? 8A E � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 10 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 16696 325 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_ec295966e8577818_=----") NIL NIL NIL VO 6Ste � 1 From: "Marie" <hotdeals_001@outlook.com> B Message-ID: <20231217153510.40E29C0F7A3F065C@outlook.com> � R Subject: ***SPAM*** =?UTF-8?B?8J+UpSBIb3QgRGVhbHMgaW4gQ3J5cHRvIEdhbWluZyDigJMgQ2xhaW0gWW91ciBFeGNsdXNpdmUg8J+SsCBUb2RheQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 17 Dec 2023 15:35:11 -0300 ; Disposition-Notification-To: caspromex@outlook.com ( Reply-To: caspromex@outlook.com \ Return-Path: <hotdeals_001@outlook.com> Return-path: <hotdeals_001@outlook.com> % To: info@bcmuslimgolfers.com ( H | � � b h Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4706 104 NIL NIL NIL NIL v# �?e � 1 From: "Marie" <hotdeals_001@outlook.com> B Message-ID: <20231218024838.B943F7AD49FE9E3B@outlook.com> � U Subject: ***SPAM*** =?UTF-8?B?8J+UpSBIb3QgRGVhbHMgaW4gQ3J5cHRvIEdhbWluZyDigJMgQ2xhaW0gWW91ciBFeGNsdXNpdmUg8J+SsCBUb2RheQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 18 Dec 2023 02:48:39 -0300 ; Disposition-Notification-To: caspromex@outlook.com ( Reply-To: caspromex@outlook.com \ Return-Path: <hotdeals_001@outlook.com> Return-path: <hotdeals_001@outlook.com> % To: info@bcmuslimgolfers.com ( H 3 � � b h Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4706 104 NIL NIL NIL NIL -$ f�e � 1 From: "Marie" <hotdeals_001@outlook.com> B Message-ID: <20231219021348.65A8DB81835F074B@outlook.com> � U Subject: ***SPAM*** =?UTF-8?B?8J+UpSBIb3QgRGVhbHMgaW4gQ3J5cHRvIEdhbWluZyDigJMgQ2xhaW0gWW91ciBFeGNsdXNpdmUg8J+SsCBUb2RheQ==?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 19 Dec 2023 02:13:48 -0300 ; Disposition-Notification-To: caspromex@outlook.com ( Reply-To: caspromex@outlook.com \ Return-Path: <hotdeals_001@outlook.com> Return-path: <hotdeals_001@outlook.com> % To: info@bcmuslimgolfers.com ( H 3 � � b h Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4706 104 NIL NIL NIL NIL -$ �&�e � 5 ) From: Rosia Coyne <merilynmatmt@hotmail.com> k 2 Message-ID: <SEZPR01MB536570C0D73E3B8F6092007FC66D2@SEZPR01MB5365.apcprd01.prod.exchangelabs.com> ) + Subject: hosting #94567_9023_amd ! , Content-Type: text/plain . - Date: Sun, 14 Jan 2024 20:17:45 +0000 \ Return-Path: <merilynmatmt@hotmail.com> Return-path: <merilynmatmt@hotmail.com> * To: info@blitzkunst.com 0 ( H w" �" X Z �" �A�e B From: Designer Watches <hello@o.o.o.integralofficegl.com> b B Subject: ***SPAM*** Limited Stock: Rolex Watches at Unbeatable Prices - Don't Miss Out! Z Content-Type: multipart/alternative; boundary="----=_001_c369a759da94f2e6_=----" . Date: Sun, 21 Jan 2024 16:04:21 +0300 l Return-Path: <hello@o.o.o.integralofficegl.com> Return-path: <hello@o.o.o.integralofficegl.com> , To: info <info@bcmuslimgolfers.com> � A � � �j l H � L P H q K O �i �j " � ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 7 0 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "8bit" 27327 290 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_c369a759da94f2e6_=----") NIL NIL NIL �x �e \ . 4 From: Eric <info@bestdigitalgrow.com> Y 7 Message-ID: <CADqb2rLgqQb8bV72OtwMWTC33PWwXcRWebQG=SGnTwLt8Yg35Q@mail.gmail.com> < 8 Subject: Quick question about : bcmuslimgolfers.com U : Content-Type: multipart/alternative; boundary="0000000000008f7dcc060f9b644c" . 5 Date: Tue, 23 Jan 2024 03:39:01 -0800 \ Return-Path: <info@bestdigitalgrow.com> Return-path: <info@bestdigitalgrow.com> 0 3 Sender: Eric <info@bestdigitalgrow.com> , 9 To: Info <info@bcmuslimgolfers.com> � A � r � H � + - H ) V Y � � � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 279 12 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 1432 19 NIL NIL NIL NIL) "alternative" ("boundary" "0000000000008f7dcc060f9b644c") NIL NIL NIL & ���e ` , From: Florence Glonn <info@lqf.com> B ! Message-ID: <68279ce031ff053ddcbf1e4cef81ea55@phimsa.com> % Subject: Introducing Funding ( Content-Transfer-Encoding: 8bit @ Content-Type: text/plain; charset=UTF-8; format=flowed . Date: Thu, 25 Jan 2024 13:52:53 +0100 / Mail-Reply-To: info@investmentlmtd.com * Reply-To: info@investmentlmtd.com D Return-Path: <info@lqf.com> Return-path: <info@lqf.com> % To: undisclosed-recipients:; ( H � � � � Z "text" "plain" ("charset" "UTF-8" "format" "flowed") NIL NIL "8bit" 409 14 NIL NIL NIL NIL C �Z�e = From: Louis Vuitton <rolex@c.c.c.overviewcenter.com> L E Subject: ***SPAM*** Louis Vuitton Bags at Only $150 - Shop Today! Z Content-Type: multipart/alternative; boundary="----=_001_be77f3f0b54fc3b6_=----" . Date: Sat, 27 Jan 2024 07:13:46 -0800 h Return-Path: <rolex@c.c.c.overviewcenter.com> Return-path: <rolex@c.c.c.overviewcenter.com> , To: info <info@bcmuslimgolfers.com> � A : � 7 ?8 H � X \ H W [ �5 �6 � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 7 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 14045 274 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_be77f3f0b54fc3b6_=----") NIL NIL NIL UE � �e � P From: "Patrick Flynn" <finance-department.investors@eu-panosonic.com> G Message-ID: <20240130044459.D84E1E6368ABE301@eu-panosonic.com> B Q Subject: ***SPAM*** Reconfirm the receipt of this email 4 " Content-Transfer-Encoding: quoted-printable ! Content-Type: text/html ) Date: 30 Jan 2024 04:44:59 +0000 ] Reply-To: zdenezturek@gmail.com alfredostenried6@gmail.com rassartthierry1@gmail.com � Return-Path: <finance-department.investors@eu-panosonic.com> Return-path: <finance-department.investors@eu-panosonic.com> % To: info@bcmuslimgolfers.com ( H � U \ U "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 348 7 NIL NIL NIL NIL �~�e � c From: "Human Resource Department" <mail02.notifications-noreply@anphenol-industrial.com> N Message-ID: <20240223043114.1913FA9E2E387B84@anphenol-industrial.com> = Subject: Employee Performance Report - December '23 4 # Content-Transfer-Encoding: quoted-printable " Content-Type: text/html ) Date: 23 Feb 2024 04:31:14 +0100 � Return-Path: <mail02.notifications-noreply@anphenol-industrial.com> Return-path: <mail02.notifications-noreply@anphenol-industrial.com> % To: info@bcmuslimgolfers.com ( H � # � l X "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 7311 108 NIL NIL NIL NIL �+ ��e � B From: "Extreme Hedge EA" <extreme_forexea001@outlook.com> B Message-ID: <20240224034104.2C20FCB8E0657E21@outlook.com> x H Subject: ***SPAM*** Discover the Forex Revolution: Trade Safely and Profitably with the New EA Extreme Hedge! 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 24 Feb 2024 03:41:04 -0300 * Reply-To: sales_boost@outlook.com h Return-Path: <extreme_forexea001@outlook.com> Return-path: <extreme_forexea001@outlook.com> % To: info@bcmuslimgolfers.com ( H a 5 i 4 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1897 52 NIL NIL NIL NIL M ���e L / From: vbh <gxhhzpfmxx@a.bubkksnubq.ru> > Message-ID: <2F97BC9928219591C26C1461FBEB2C90@aqrhdc> b G Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_4629233748edbfde_=----" . Date: Tue, 27 Feb 2024 05:43:16 -0800 ` Return-Path: <gxhhzpfmxx@a.bubkksnubq.ru> Return-path: <gxhhzpfmxx@a.bubkksnubq.ru> , To: info <info@bcmuslimgolfers.com> � A � � P x H � X \ H p W [ � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 271 5 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 782 19 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_4629233748edbfde_=----") NIL NIL NIL � -��e 8 8 From: Demetrius Adams<ventas56@acousticgen.org> F Message-ID: <20240228183446.90295A64570DCCF6@acousticgen.org> ' L Subject: ***SPAM*** Reminder 4 Content-Transfer-Encoding: quoted-printable Content-Type: text/html ) Date: 28 Feb 2024 18:34:46 +0000 & Reply-To: info@out-claims.com \ Return-Path: <ventas56@acousticgen.org> Return-path: <ventas56@acousticgen.org> % To: info@bcmuslimgolfers.com ( H � � � � V "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 494 13 NIL NIL NIL NIL e �~�e 3 From: Rolex <ctxwqqhsq@medarcosmetics.com> I I Subject: ***SPAM*** Rolex Watches only $250 Today. Don't Miss. Z Content-Type: multipart/alternative; boundary="----=_001_68a3f5532208ba5a_=----" - Date: Sun, 3 Mar 2024 10:16:29 +0100 d Return-Path: <ctxwqqhsq@medarcosmetics.com> Return-path: <ctxwqqhsq@medarcosmetics.com> , To: info <info@bcmuslimgolfers.com> � A � 3 �= :? H : X \ H � W [ �< �= 4 � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 10 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 15829 308 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_68a3f5532208ba5a_=----") NIL NIL NIL �L +@�e � 7 7 From: Lily Clibborn <lily@webtechresearch.com> Y : Message-ID: <CAGNTsEto1w345iQS7ugO5uevG0dacNvb4ihB1MPU2OJqHo9TJw@mail.gmail.com> B ; Subject: bcmuslimgolfers.com: SEO at Low Cost Interested. U = Content-Type: multipart/alternative; boundary="00000000000016088d0612e6bbde" - 8 Date: Tue, 5 Mar 2024 01:47:30 -0800 \ Return-Path: <lily@webtechresearch.com> Return-path: <lily@webtechresearch.com> 9 6 Sender: Lily Clibborn <lily@webtechresearch.com> , < To: Info <info@bcmuslimgolfers.com> � A 0 � B � H O W Z � � , H � V Y u � . � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1771 44 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 3491 46 NIL NIL NIL NIL) "alternative" ("boundary" "00000000000016088d0612e6bbde") NIL NIL NIL r* d��e 0 / From: Owen Archer <info457@bonitoz.cc> A Message-ID: <20240309232840.E3F7C739CF7D70F4@bonitoz.cc> 1 K Subject: ***SPAM*** appointment notice 4 Content-Transfer-Encoding: quoted-printable Content-Type: text/html ( Date: 9 Mar 2024 23:28:40 -0800 . Reply-To: owenarcher@investmentlc.com P Return-Path: <info457@bonitoz.cc> Return-path: <info457@bonitoz.cc> % To: info@bcmuslimgolfers.com ( H � G $ V "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 548 10 NIL NIL NIL NIL Sb�e � X From: " Mail Online Service " <notifications-mail107.noreply@mediliuxoil.com> F Message-ID: <20240322043811.8F8ECF5038757172@mediliuxoil.com> n Subject: [Ticket:MKY-56FGW] Re:**IMPORTANT** Update settings to keep info@bcmuslimgolfers.com Safe. 4 " Content-Transfer-Encoding: quoted-printable ! Content-Type: text/html ) Date: 22 Mar 2024 04:38:11 +0100 � Return-Path: <notifications-mail107.noreply@mediliuxoil.com> Return-path: <notifications-mail107.noreply@mediliuxoil.com> % To: info@bcmuslimgolfers.com ( H R �+ �, � Y "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 11397 164 NIL NIL NIL NIL �< ��e \ / $ From: James May <james@payday.holiday> L & Message-ID: <JwRw5k1lWiwko4JrxV6lSf1nCeUqKh8tJPyyr3mdSzk@localhost> M S Subject: ***SPAM*** Business & Consumer Leads for The Entire World * * Content-Transfer-Encoding: base64 / ) Content-Type: text/html; charset=UTF-8 - " Date: Thu, 4 Apr 2024 18:11:06 +0200 0 % Reply-To: James <waraye8132@cutsup.com> T Return-Path: <james@payday.holiday> Return-path: <james@payday.holiday> % # To: info@bcmuslimgolfers.com ( H ! u � � I "text" "html" ("charset" "UTF-8") NIL NIL "base64" 910 13 NIL NIL NIL NIL � M�f T 3 # From: James May <james@paydaysearcher.com> L % Message-ID: <m8MaSKsVnZa72xVOGDdrjKtwrYBV6uPu3g1xHseVCbY@localhost> < Q Subject: ***SPAM*** DataLeadsFinder Shutting Down * ) Content-Transfer-Encoding: base64 / ( Content-Type: text/html; charset=UTF-8 . ! Date: Wed, 10 Apr 2024 16:04:09 +0200 - $ Reply-To: James <data@marketboy.biz> \ Return-Path: <james@paydaysearcher.com> Return-path: <james@paydaysearcher.com> % " To: info@bcmuslimgolfers.com ( H � � � I "text" "html" ("charset" "UTF-8") NIL NIL "base64" 922 13 NIL NIL NIL NIL Q d�f @ + From: no-reply@bcmuslimgolfers.com J Message-ID: <20240419095354.B40F7D7A54067F18@bcmuslimgolfers.com> S B Subject: ***SPAM*** =?UTF-8?B?RS1NYWlsIFNlY3VyaXR5IFVwZGF0ZeG1gOG0uSAg?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 19 Apr 2024 09:53:54 +0200 J Return-Path: <eeskcadc@arh.ae> Return-path: <eeskcadc@arh.ae> % To: info@bcmuslimgolfers.com ( H � 3 k* + � [ "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 11032 173 NIL NIL NIL NIL [8 A#"f = From: Louis Vuitton <infobartended@k.sharesound.net> d Message-Id: <YKHAQTLQHA.77924745853893555015292DYBNLSCKGJET.8ZHRGEPAOBJJL@k.sharesound.net> V L Subject: ***SPAM*** Affordable Elegance - LV Bags for Just $150 - Shop Now! � Content-Type: multipart/alternative; boundary="__==___-==__lgawjlwaynuv3mft4ufcaf3moyirsqvspvozpu1vmtbmx3senn32f1j3y4vx1k11has6cpzvmrnfhabag3v0cfywmu3jomrtgrxzdfszycysja6vp9sz9b0845x9pr15iaq18qfm7f5apjiw__==---__" , Date: Thu, 2 May 2024 18:12:08 +000 h Return-Path: <infobartended@k.sharesound.net> Return-path: <infobartended@k.sharesound.net> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � � �3 =4 H w S W H � R V �0 F1 b H jD � ("text" "plain" ("charset" "windows-1255") NIL NIL "8bit" 23 1 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1255") NIL NIL "8bit" 12614 98 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___-==__lgawjlwaynuv3mft4ufcaf3moyirsqvspvozpu1vmtbmx3senn32f1j3y4vx1k11has6cpzvmrnfhabag3v0cfywmu3jomrtgrxzdfszycysja6vp9sz9b0845x9pr15iaq18qfm7f5apjiw__==---__") NIL NIL NIL kD ��3f � ; * From: "Simran" <seorankingsolutions71@outlook.com> o . Message-ID: <TY0PR0101MB40968901BD03626899E1371EBF1F2@TY0PR0101MB4096.apcprd01.prod.exchangelabs.com> - , Subject: Regarding: Increase Traffic c 0 Content-Type: multipart/alternative; boundary="----=_NextPart_000_0047_01DA9DAA.39DDA880" - - Date: Fri, 3 May 2024 22:34:57 +0530 n Return-Path: <seorankingsolutions71@outlook.com> Return-path: <seorankingsolutions71@outlook.com> 9 + To: "Simran" <seorankingsolutions71@outlook.com> � A U# �# � ( H �# O S � � H �% Z ^ � J ^ � ("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 416 25 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 2634 94 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0047_01DA9DAA.39DDA880") NIL ("en-in") NIL �/ �5f � 7 From: Ray Ban <infostorey@k.ascmechanical.com> s Message-ID: <mbkrr-LLYKKTNXWSK8Y52WGJ1G3AZSO-SYMBS7L3HJL13C36SSG-wrl2yg7emr0224794937@k.ascmechanical.com> f ? Subject: ***SPAM*** Top Brand Sunglasses at a Fraction of the Price - Starting from $27.99! � Content-Type: multipart/alternative; boundary="____--__--3hzqqokckvrmc7fiqbdslczdsmfls3upcye2jn1fsv2yyieaky0dgqc5umgls3pun4xfujtvxztpttyn0ktz5zexrnu7kwmdbpmoocsdig2dyc9--__--____" - Date: Sun, 5 May 2024 02:57:22 -0800 h Return-Path: <infostorey@k.ascmechanical.com> Return-path: <infostorey@k.ascmechanical.com> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A [ � gA �A H S W H � R V �> d? } H �N � ("text" "plain" ("charset" "windows-1253") NIL NIL "8bit" 22 0 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1253") NIL NIL "8bit" 16228 125 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "____--__--3hzqqokckvrmc7fiqbdslczdsmfls3upcye2jn1fsv2yyieaky0dgqc5umgls3pun4xfujtvxztpttyn0ktz5zexrnu7kwmdbpmoocsdig2dyc9--__--____") NIL NIL NIL �N CX7f < 3 From: "SUPER LIST" <fcalnyumik@sgssoft.ir> P 0 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Mon, 6 May 2024 03:12:11 +0300 V Return-Path: <fcalnyumik@sgssoft.ir> Return-path: <fcalnyumik@sgssoft.ir> + To: mountainmoondesignco@gmail.com 0 ( a � I * � � 8f ` . From: Ray Ban <jxqky@a.daxecehkaj.ru> A Message-ID: <84CEF1941D784939913997B414759AFE@svyruyhwl> g D Subject: ***SPAM*** Ray Ban Sunglasses Up To 90% Off! Top Quality Low Cost! Shop Online Now! * Content-Transfer-Encoding: base64 2 Content-Type: text/html; charset="utf-8" - Date: Mon, 6 May 2024 18:21:40 -0800 V Return-Path: <jxqky@a.daxecehkaj.ru> Return-path: <jxqky@a.daxecehkaj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 ( H j � 8 D I "text" "html" ("charset" "utf-8") NIL NIL "base64" 836 12 NIL NIL NIL NIL � [�9f , , From: webmaster@bcmuslimgolfers.com J Message-ID: <20240508052314.AE53835525BD4D86@bcmuslimgolfers.com> 2 @ Subject: ***SPAM*** System Error Report 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 08 May 2024 05:23:14 +0200 X Return-Path: <ajmal@aldhafra-uae.com> Return-path: <ajmal@aldhafra-uae.com> % To: info@bcmuslimgolfers.com ( H � �! N" z Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 8782 122 NIL NIL NIL NIL �. Q�:f \ . From: Ray Ban <cpqbz@a.daxecehkaj.ru> @ Message-ID: <8E1F74FF51008E92EAFD94737AB17202@conwbzap> g L Subject: ***SPAM*** Ray Ban Sunglasses Up To 90% Off! Top Quality Low Cost! Shop Online Now! * Content-Transfer-Encoding: base64 2 Content-Type: text/html; charset="utf-8" - Date: Wed, 8 May 2024 20:00:11 -0800 V Return-Path: <cpqbz@a.daxecehkaj.ru> Return-path: <cpqbz@a.daxecehkaj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 ( H m � 8 D I "text" "html" ("charset" "utf-8") NIL NIL "base64" 836 12 NIL NIL NIL NIL � u<<f P , From: Ray Ban <qyz@a.tutahqdqyx.ru> < Message-ID: <6E921569538C2A611FA2C4D3DB19AA66@yemt> g J Subject: ***SPAM*** Ray Ban Sunglasses Up To 90% Off! Top Quality Low Cost! Shop Online Now! * Content-Transfer-Encoding: base64 2 Content-Type: text/html; charset="utf-8" . Date: Fri, 10 May 2024 00:26:24 -0800 R Return-Path: <qyz@a.tutahqdqyx.ru> Return-path: <qyz@a.tutahqdqyx.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 ( H � / 8 D I "text" "html" ("charset" "utf-8") NIL NIL "base64" 836 12 NIL NIL NIL NIL Z�=f \ ; From: Porter Cousin <medlen@sedl.xn--c1aeausy.com> B " Message-ID: <YzT6-YzT6-YzT6-zNDOBq@sedl.xn--c1aeausy.com> / Subject: Flaming Signals of Attraction Y # Content-Type: multipart/alternative; boundary="2678ywpxshbycl1rmziio4hf02a4awpb" . Date: Fri, 17 May 2024 13:59:25 -0700 0 ! Reply-To: <unsub@sedl.xn--c1aeausy.com> d Return-Path: <medlen@sedl.xn--c1aeausy.com> Return-path: <medlen@sedl.xn--c1aeausy.com> % To: info@bcmuslimgolfers.com � A T � g � H w \ _ H � T W C [ � ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 7 0 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "quoted-printable" 1883 24 NIL NIL NIL NIL) "alternative" ("boundary" "2678ywpxshbycl1rmziio4hf02a4awpb") NIL NIL NIL � G�Gf l 4 From: mdpmdoubp <jtcjxumah@a.jvhwtkwlwl.ru> B Message-ID: <370C0E421C5D6B3046A7BD7C8D2934B6@qasqjyvsch> b O Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_cb7fdfd4a3c2df6a_=----" . Date: Thu, 30 May 2024 10:05:28 -0800 ^ Return-Path: <jtcjxumah@a.jvhwtkwlwl.ru> Return-path: <jtcjxumah@a.jvhwtkwlwl.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � � U } H � X \ H � W [ � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 271 5 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 787 19 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_cb7fdfd4a3c2df6a_=----") NIL NIL NIL � �Xf 0 = From: Ray Ban <infolampoon@k.spokanegroceryboys.com> � Message-ID: <y2w0ygyrlpnmlnmoinbwidvwcq2nsqawhfhpbdggdnnfna8h9r3cjrg9x4gapsjtxhytuyupjdapnobeeew7ghynrsd4irgdfbwxf9nx09x2v7e0egqvmdcn8-in6.0swkyhi8m.mails@k.spokanegroceryboys.com> O L Subject: ***SPAM*** Top Brand Sunglasses for Just $27.99 - Shop Now! � Content-Type: multipart/alternative; boundary="===____====yojvpukjyijcvejrumcizopfij6kwkzodmohgn9wnof3aom3lyaihabx6qzuzx728k5cbfl0kb1yyz7f0og8i6p7ldlkujt14rnl0uhstkyk6====____====" - Date: Wed, 5 Jun 2024 12:56:25 -0800 t Return-Path: <infolampoon@k.spokanegroceryboys.com> Return-path: <infolampoon@k.spokanegroceryboys.com> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A 9 � [6 �6 H � S W H � R V �3 =4 l H �G � ("text" "plain" ("charset" "windows-1255") NIL NIL "8bit" 29 0 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1255") NIL NIL "8bit" 13373 108 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "===____====yojvpukjyijcvejrumcizopfij6kwkzodmohgn9wnof3aom3lyaihabx6qzuzx728k5cbfl0kb1yyz7f0og8i6p7ldlkujt14rnl0uhstkyk6====____====") NIL NIL NIL �G %�`f � G From: Louis Vuitton <infokdwha6xpiqued@z2.goingtovegaspod.com> [ Message-ID: <A596482954991116L5ONVXVR0TJMCFGU4HEYJ.UVHN453@z2.goingtovegaspod.com> B K Subject: ***SPAM*** LV Bags on Sale - Starting at $150! c Content-Type: multipart/alternative; boundary="___-jpu1fadeqmxevgco7vl3opxk669wgy2ns-___" , Date: Sat, 8 Jun 2024 18:51:51 +000 | Return-Path: <infokdwha6xpiqued@z2.goingtovegaspod.com> Return-path: <infokdwha6xpiqued@z2.goingtovegaspod.com> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A = � �3 �3 H � L P H " K O &2 �2 c � ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 18 0 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "8bit" 12937 99 NIL NIL NIL NIL) "alternative" ("boundary" "___-jpu1fadeqmxevgco7vl3opxk669wgy2ns-___") NIL NIL NIL �C u�df � < From: Ray Ban <infodenomination@w.magicjacktwo.com> � Message-ID: <q5g8n.nqfr1vz-w32wyt12.psv7wazmeatbdkqe2epy7kutbce9rzf44ztypx9ystatmxisg-ncrlftby-ddglrxutz@w.magicjacktwo.com> ` M Subject: ***SPAM*** Don't Delay, Save Big: Top Brand Sunglasses at Unbeatable Prices! � Content-Type: multipart/alternative; boundary="----+_ryrualaij2a42rbrhfoc87bwkgpqtemgvqedjvbj2oa02i8yq1quvsyjoxvqx4sf6eojqeaguohvvkiudzb5fcdyt5vyok02xuuyvt_+----" . Date: Sat, 15 Jun 2024 12:54:29 -0800 r Return-Path: <infodenomination@w.magicjacktwo.com> Return-path: <infodenomination@w.magicjacktwo.com> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � = �I �J H � S W H k R V �G ,H | H �Z � ("text" "plain" ("charset" "windows-1256") NIL NIL "8bit" 16 0 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1256") NIL NIL "8bit" 18476 124 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "----+_ryrualaij2a42rbrhfoc87bwkgpqtemgvqedjvbj2oa02i8yq1quvsyjoxvqx4sf6eojqeaguohvvkiudzb5fcdyt5vyok02xuuyvt_+----") NIL NIL NIL �Z ��mf ` A From: "Boost Your Sales" <boost-sales-today@outlook.com> B Message-ID: <20240622184617.EBB8E2BD56BE6D7A@outlook.com> P A Subject: ***SPAM*** Increase Your Sales with the BEST Emails of WORLD 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 22 Jun 2024 18:46:17 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H � @ � q V "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 3249 113 NIL NIL NIL NIL � VFwf | 5 From: Rolex <infoplastered@z.quanjiaren.net> l Message-ID: <030417844776.MONEY_ACCOUNT_OBTAINING_MBUS@ILmhz1k-FHqOaT3BT2eF0LcBdm0CqgH08No7iUznG0c> P F Subject: ***SPAM*** Top Watches at Unbeatable Prices - Limited Stock! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1257" . Date: Tue, 25 Jun 2024 09:15:49 +0100 h Return-Path: <infoplastered@z.quanjiaren.net> Return-path: <infoplastered@z.quanjiaren.net> , To: info <info@bcmuslimgolfers.com> ( H � � 3 t3 l Q "text" "html" ("charset" "windows-1257") NIL NIL "8bit" 13172 108 NIL NIL NIL NIL �A �nzf ` 4 # From: James Cooper <james@marketingfff.com> I & Message-ID: <O0Ea8OEEZVVtXvLE1legCHUGF79jIXHJbLj61rO0@localhost> C % Subject: Your website is listed in only a few directories. * * Content-Transfer-Encoding: base64 / ) Content-Type: text/html; charset=UTF-8 . ! Date: Wed, 26 Jun 2024 13:13:11 +0200 8 $ Reply-To: Your Website <james@marketingfff.com> X Return-Path: <james@marketingfff.com> Return-path: <james@marketingfff.com> % " To: info@bcmuslimgolfers.com ( H � & � � J "text" "html" ("charset" "UTF-8") NIL NIL "base64" 1428 20 NIL NIL NIL NIL T ��{f 5 From: Rolex <replant@kk.perawatanrambut.net> � Message-ID: <S7GR3.SNIBXHX5EQCNPK8HXDQ6SQT5WI2DAKEODQGMON0ZKHCLPDFFRCHK7DAIOQN0ONSTG0GAR1D9WWNQZCB4USB3ASMMMSLMQTNWMXZBI34VKLVINBZN8KSMU1KWILHMPLLIC24CWYTJLFQRVTN7B@YYQlOWAnMFNcQMaGMQVHXTOqbFWYgXcbTMhWIPMiUaEhJqSkgDhbmWYKKt> W G Subject: ***SPAM*** Luxury for Less: Top Watches on Sale - Starting at $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" . Date: Fri, 28 Jun 2024 08:22:39 +0100 h Return-Path: <replant@kk.perawatanrambut.net> Return-path: <replant@kk.perawatanrambut.net> , To: info <info@bcmuslimgolfers.com> ( H � 8 �8 l Q "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 14473 108 NIL NIL NIL NIL �G �V~f 6 From: Rolex <suddenly@kk.perawatanrambut.net> � Message-ID: <LEM27.YCUT3MM9KTOVYENVVY9KUYWUETU12DKB0PYTM5L36H8XSCUKSYKDG9GIGBY8WNZLVAOAUUSG7QKP51Q365KBZWCKTDEGJ9YGUWVQLY29D4UCFVZDBRJCLKCKOEAQBUADO9KMTW3KJKREXLHT2@YYQlOWAnMFNcQMaGMQVHXTOqbFWYgXcbTMhWIPMiUaEhJqSkgDhbmWYKKt> W E Subject: ***SPAM*** Luxury for Less: Top Watches on Sale - Starting at $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" - Date: Mon, 1 Jul 2024 01:24:47 +0100 j Return-Path: <suddenly@kk.perawatanrambut.net> Return-path: <suddenly@kk.perawatanrambut.net> , To: info <info@bcmuslimgolfers.com> ( H 5 { 8 �8 l Q "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 14471 108 NIL NIL NIL NIL PG v�f � 4 From: Ray Ban <infoflagging@d.1000kata.net> � Message-ID: <zxh7w2khbsedorexwq1pffxfpueu7ls2zmciwiey1b8wbcohqiq14uu7omkhmexkfqv.rtvqq4w8dl.lablvmac.xcflbtcx45t@mciwiey1b8wbcohqiq14uu7omkhmexkfqv> T ? Subject: ***SPAM*** Top Brand Sunglasses Starting at $27.99 - Shop Today! ( Content-Transfer-Encoding: 8bit 2 Content-Type: text/html; charset="utf-8" - Date: Wed, 3 Jul 2024 02:03:18 +0930 b Return-Path: <infoflagging@d.1000kata.net> Return-path: <infoflagging@d.1000kata.net> , To: info <info@bcmuslimgolfers.com> ( H F @0 �0 \ I "text" "html" ("charset" "utf-8") NIL NIL "8bit" 12444 92 NIL NIL NIL NIL F= ,�f � 5 From: Louis Vuitton <consider@c.ritmovi.net> p Message-ID: <tmbarutzshwuorvolxogcrupnywamo.lrrxhauwygy.mvnpzdsesfz.hf@nYLnpjZLgTSSpYLkXLGoXGbqkYRInWg> a H Subject: ***SPAM*** Top Bags at a Fraction of the Original Price - Starting from $150! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1257" , Date: Fri, 5 Jul 2024 02:33:34 +000 X Return-Path: <consider@c.ritmovi.net> Return-path: <consider@c.ritmovi.net> , To: info <info@bcmuslimgolfers.com> ( H 7 � �+ T, l Q "text" "html" ("charset" "windows-1257") NIL NIL "8bit" 11348 108 NIL NIL NIL NIL ; �M�f ; From: Rolex <telecommuting@kk.perawatanrambut.net> � Message-ID: <JDOBE.8HAMRUQBFWQVLYXZRBJBE3KCJIO5L5BZTIOI5BNRDYX4S93CP78KUSMRLFWYBA9XRQFJWI0KC5MWVHBWVRCTNTNMRHKDI30WRU0KVLGCEOYCNJFUNQUQZLQYVTJREBU4OYNMLFCQYEBLKODC0@YYQlOWAnMFNcQMaGMQVHXTOqbFWYgXcbTMhWIPMiUaEhJqSkgDhbmWYKKt> W E Subject: ***SPAM*** Luxury for Less: Top Watches on Sale - Starting at $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" - Date: Fri, 5 Jul 2024 19:33:10 +0100 t Return-Path: <telecommuting@kk.perawatanrambut.net> Return-path: <telecommuting@kk.perawatanrambut.net> , To: info <info@bcmuslimgolfers.com> ( H L � %8 �8 l Q "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 14481 108 NIL NIL NIL NIL qG �.�f 8 : From: Edward V. Bowers<ventasnorte@freniteca.com> D Message-ID: <20240705204911.51016161A48149EE@freniteca.com> ! Subject: Payment Notice 4 Content-Transfer-Encoding: quoted-printable Content-Type: text/html ( Date: 5 Jul 2024 20:49:11 -0700 * Reply-To: ebowers@zublightlaw.com ^ Return-Path: <ventasnorte@freniteca.com> Return-path: <ventasnorte@freniteca.com> % To: info@bcmuslimgolfers.com ( H 4 o $ V "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 548 10 NIL NIL NIL NIL N Èf X @ From: "Eduardo - LEADS" <boost-sales-today@outlook.com> B Message-ID: <20240706065559.99EBC4B25A9F517A@outlook.com> T B Subject: ***SPAM*** Experts and Over 1,000 Customers Recommend Our Lists! 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 6 Jul 2024 06:55:59 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H G � � T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 452 22 NIL NIL NIL NIL � ��f t @ From: "Eduardo - LEADS" <boost-sales-today@outlook.com> B Message-ID: <20240707075917.2B663B70F9F54A25@outlook.com> l B Subject: ***SPAM*** Infinite Leads Forever - Experts and Over 1,000 Customers Recommend Our Apps! 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 7 Jul 2024 07:59:17 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H a Z � + U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1413 43 NIL NIL NIL NIL x 2u�f h > From: "SALES BOOSTER" <boost-sales-today@outlook.com> B Message-ID: <20240708090116.E1C3B7659DAB1F2B@outlook.com> ] C Subject: ***SPAM*** Boost Your Sales with Expert-Recommended Lead Generation Tools 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ( Date: 8 Jul 2024 09:01:17 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H + o Y � 0 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1417 48 NIL NIL NIL NIL � ?Ջf � / From: Rolex <dancer@99.repromatic.net> � Message-ID: <RVHQYMXFA9TWd65fh46d5yg.5Y7CWCYMWERNFV4ESPB91W.AGQYBN9MPBWDNWEPGBYV5SVSOMBRWTNAZDK@38923fdg1h3e1r5y45gdfhreyet> I Subject: Hottest Watches on Sale for a Limited Time - Only $250! � Content-Type: multipart/alternative; boundary="----__=-khsfzpqtmlky1pbg5kset9dspeeueen2t2dqw9nhttdpliqvh8iawn1nvp5vyasb9uu6e81bbqhecbiw2ht8bo6g3aeqts2wsd8c7zgmyyzxhovbkegdp4jpiygnsw6fsolg-=__----" - Date: Mon, 8 Jul 2024 20:43:35 +0100 \ Return-Path: <dancer@99.repromatic.net> Return-path: <dancer@99.repromatic.net> , To: info <info@bcmuslimgolfers.com> � A � � �1 Y2 H c S W H Y R V >/ �/ c H �> � ("text" "plain" ("charset" "windows-1251") NIL NIL "8bit" 11 0 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1251") NIL NIL "8bit" 12193 99 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "----__=-khsfzpqtmlky1pbg5kset9dspeeueen2t2dqw9nhttdpliqvh8iawn1nvp5vyasb9uu6e81bbqhecbiw2ht8bo6g3aeqts2wsd8c7zgmyyzxhovbkegdp4jpiygnsw6fsolg-=__----") NIL NIL NIL �> �3�f | , From: Jack <rocking@h.you2crew.net> � Message-ID: <XCYMOMSM3ZVKXC-VGBASHNJ0OQB-QUVWIFGC5FEDPOV5SZ-WRETUL5HTAHWZH4MI96T@fHkckSKoqNQhVGKFoSNFjSZnCeCljHTUnPhglLm> c > Subject: ***SPAM*** Unbeatable Discount: Top Sunglasses Starting at $27.99 - Shop Today! ( Content-Transfer-Encoding: 8bit 2 Content-Type: text/html; charset="utf-8" . Date: Wed, 10 Jul 2024 11:02:50 +0930 X Return-Path: <rocking@h.you2crew.net> Return-path: <rocking@h.you2crew.net> , To: info <info@bcmuslimgolfers.com> ( H � ) �- 5. ` I "text" "html" ("charset" "utf-8") NIL NIL "8bit" 11829 96 NIL NIL NIL NIL �: �f l > From: "SALES BOOSTER" <boost-sales-today@outlook.com> B Message-ID: <20240710044256.17B21E83D1F99BFE@outlook.com> ] A Subject: ***SPAM*** Boost Your Sales with Expert-Recommended Lead Generation Tools 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 10 Jul 2024 04:42:56 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H � { � 2 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 1453 50 NIL NIL NIL NIL = �;�f ` 0 From: Rolex <syl12pdmdy9@a.jjsd4fuj.ru> < Message-ID: <1953957953D4DBE5D5665A7B247060F3@uzch> b I Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_5efd56aa0055df26_=----" . Date: Sun, 14 Jul 2024 05:27:09 -0800 ^ Return-Path: <syl12pdmdy9@a.jjsd4fuj.ru> Return-path: <syl12pdmdy9@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � G ( U H N X \ Z b H $ W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 664 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_5efd56aa0055df26_=----") NIL NIL NIL % Sēf � 1 From: Ray Ban <cooperation@1.jwcorp.net> � Message-ID: <f1llw6s3ecxrypb.he1cdpj7fukic6egf0892fud3xdaxudvpimhr6iefeoyi-jtnj4.sd5fg46wfe4r86s4df65ewrq7wf9p7ycdvkcnd@iLadf6g57er6t8erZrYAgikSC> [ < Subject: ***SPAM*** Hottest Sunglasses on Sale for a Limited Time - Only $27.99! � Content-Type: multipart/alternative; boundary="____==___om6x0sniwpnn2ixoameut334fkvtnvmqeit64ouey9od0mlf084sakn4wcrj4etj8vxfpcih5kymrmt3vvg5fwvkumgkyzsifehkocfufac-____==" . Date: Mon, 15 Jul 2024 23:03:14 +0930 \ Return-Path: <cooperation@1.jwcorp.net> Return-path: <cooperation@1.jwcorp.net> , To: info <info@bcmuslimgolfers.com> � A � 7 �B QC H � S W H � R V d@ �@ } H �O � ("text" "plain" ("charset" "windows-1251") NIL NIL "8bit" 14 0 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1251") NIL NIL "8bit" 16609 125 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "____==___om6x0sniwpnn2ixoameut334fkvtnvmqeit64ouey9od0mlf084sakn4wcrj4etj8vxfpcih5kymrmt3vvg5fwvkumgkyzsifehkocfufac-____==") NIL NIL NIL �O Z%�f T 4 # From: James Cooper <james@marketingbox.biz> L % Message-ID: <Wl4WEltGSkvtgZrJi9fqaQsEXE7uQZTiIEmTru0Fqg8@localhost> : V Subject: ***SPAM*** LeadsMax.biz shutting down. * ) Content-Transfer-Encoding: base64 / ( Content-Type: text/html; charset=UTF-8 . ! Date: Wed, 17 Jul 2024 22:18:02 +0200 8 $ Reply-To: Your Website <james@marketingbox.biz> X Return-Path: <james@marketingbox.biz> Return-path: <james@marketingbox.biz> % " To: info@bcmuslimgolfers.com ( H � M r x H "text" "html" ("charset" "UTF-8") NIL NIL "base64" 376 6 NIL NIL NIL NIL h Z'�f h 9 ) From: Dave Thompso <DaveThompso1919@outlook.com> f - Message-ID: <CH0PR20MB3852C20FB28DCB255A54A507B8AD2@CH0PR20MB3852.namprd20.prod.outlook.com> , � Subject: ***SPAM*** Re: Estimate? w Content-Type: multipart/alternative; boundary="_000_CH0PR20MB3852C20FB28DCB255A54A507B8AD2CH0PR20MB3852namp_" . , Date: Fri, 19 Jul 2024 11:37:20 +0000 g W In-Reply-To: <CH0PR20MB3852A89B61CF5380D9AC0A19B8A22@CH0PR20MB3852.namprd20.prod.outlook.com> � / References: <CH0PR20MB3852DB32F18F9C48BBB4B932B8342@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38529A84110F5FD7DDA93C3AB8342@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38521780B1A2C5083DA65995B83B2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38524D06CF53EE9BADEEBB5AB8102@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385204815AB1B1393F650397B8E62@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38525AC1D47B83E532B19A73B8E22@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852CFC79CCF2517E4D5BD54B8E32@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852FF600248A82D05E668F5B8ED2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852D4B4869F44EC49D87063B8EA2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B4530632EE9F09428E85B8EB2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385287FF2D8E2F1877B9A749B8F52@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385216205F49272682ED44F0B8F52@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385238C19CE6DC7CE2858555B8F02@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B390DBFF1E35BF436DB9B8F12@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852F0FF87E3EF557D2B0C22B8F32@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38529ADC89608D0F5A653CDEB8FC2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852878EA48A292D1D70A66CB8FF2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38521E0F4D4819F34B8A8BB5B8F82@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385253BE1D8A70D123DC6443B8F92@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385278F64CAC03D27E408ADBB8FA2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852E3433A792D5222EF0EBEB8FB2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B95EA7EE6BCE8F004ED8B8C02@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385272D9CCFEF4A816970099B8C12@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385239DE1CCBBB0EECB21313B8CE2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B6FD3F8D95012C98E6E6B8CF2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38521D06208951589130BB8AB8C92@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38527C431194A7464BB88AFCB8D42@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852C4FBE895B4A7A2E7D8C7B8D52@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385206F8B49454F1F0AA5528B8D62@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B64E84F2115C6C77CCB6B8D72@CH0PR20MB3852.namprd20.prod.outlook.com> <BLAPR20MB3841020C3BE70D4837A3FBA7B8D02@BLAPR20MB3841.namprd20.prod.outlook.com> <CH0PR20MB38527FCE0AB7F09EFE6DE3DEB8DC2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852F86C22915D2BFD3D7B2FB8DD2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB385214E48448B408DA155F78B8DE2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB38527CBF263A27791BA72E8CB8DF2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852D108C4DCDCD83773CA92B8DA2@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852B98FE9001B8F7089490FB8A42@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852D4020BF124D57884820AB8A12@CH0PR20MB3852.namprd20.prod.outlook.com> <CH0PR20MB3852A89B61CF5380D9AC0A19B8A22@CH0PR20MB3852.namprd20.prod.outlook.com> b Return-Path: <DaveThompso1919@outlook.com> Return-path: <DaveThompso1919@outlook.com> � A �3 �4 � @ H 4 \ _ O ] H �5 [ ^ ] Z # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 349 14 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4445 90 NIL NIL NIL NIL) "alternative" ("boundary" "_000_CH0PR20MB3852C20FB28DCB255A54A507B8AD2CH0PR20MB3852namp_") NIL ("en-US") NIL �G $P�f p 4 From: Rolex <u2k8dafd1zynmx1@a.jjsd4fuj.ru> ? Message-ID: <C5204011FD217B167EE7AD0C31231D48@lpgyrxl> b O Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_571f4c84ab5ddc0a_=----" . Date: Fri, 19 Jul 2024 07:27:27 -0800 f Return-Path: <u2k8dafd1zynmx1@a.jjsd4fuj.ru> Return-path: <u2k8dafd1zynmx1@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � � ( U H � X \ Z b H � W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 664 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_571f4c84ab5ddc0a_=----") NIL NIL NIL � x�f , 4 From: sandra Dawson<info@klimatherm-eco.gr> H Message-ID: <20240724062422.4529C0588EB24569@klimatherm-eco.gr> Subject: Payment Notice 4 Content-Transfer-Encoding: quoted-printable Content-Type: text/html ) Date: 24 Jul 2024 06:24:22 -0700 + Reply-To: sandra.d@ublightlaws.net X Return-Path: <info@klimatherm-eco.gr> Return-path: <info@klimatherm-eco.gr> % To: info@bcmuslimgolfers.com ( H � � � d X "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 6918 100 NIL NIL NIL NIL D% 9�f \ 9 From: DocuSign NA3 System <dse_NA3@docusign.net> C Message-ID: <20240725010611.305117B78E741B50@docusign.net> � F Subject: ***SPAM*** =?UTF-8?B?Q29tcGxldGVkOiBBY3Rpb24gTmVlZGVkOiBSZXF1ZXN0IDA3NSAtIDEyNzMxOSDigJMgU2lnbmF0dXJlIG5lZWRlZCBmb3IgeW91ciBjb250cmFjdHVhbCBkb2N1bWVudHMgW0ZJRDIwMDA3ODld?= _ Content-Type: multipart/related; boundary="----=_NextPart_000_0012_EBDBF75B.566BB5F7" ) Date: 25 Jul 2024 01:06:12 +0200 T Return-Path: <dse_NA3@docusign.net> Return-path: <dse_NA3@docusign.net> % To: info@bcmuslimgolfers.com � A � Ԑ � H � \ ` >k �l � @ s{ } � P � @ m� y } = v � ("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 27843 389 NIL NIL NIL NIL)("image" "png" ("name" "logo-ds-116x33@2x.png") "<logo-ds-116x33@2x.png>" NIL "base64" 5012 NIL NIL NIL NIL)("image" "png" ("name" "docinvite-white.png") "<docinvite-white.png>" NIL "base64" 4214 NIL NIL NIL NIL) "related" ("boundary" "----=_NextPart_000_0012_EBDBF75B.566BB5F7") NIL NIL NIL S� ��f � Z ! From: support <sender-2845190fe4219e0a7bd023fe1f3ed476@lebenshaus-jerusalem.org> I ( Message-Id: <20240728101447.0E2B19063F@lebenshaus-jerusalem.org> 3 Subject: Important: Domain Renewal Notice. / Content-type: text/html; charset=UTF-8 4 ) Date: Sun, 28 Jul 2024 10:14:47 +0000 (UTC) S " Reply-To: sender-2845190fe4219e0a7bd023fe1f3ed476@lebenshaus-jerusalem.org � Return-Path: <sender-2845190fe4219e0a7bd023fe1f3ed476@lebenshaus-jerusalem.org> Return-path: <sender-2845190fe4219e0a7bd023fe1f3ed476@lebenshaus-jerusalem.org> % To: info@bcmuslimgolfers.com # X-Priority: 3 ( H � � � # M H "text" "html" ("charset" "UTF-8") NIL NIL "7bit" 3107 77 NIL NIL NIL NIL [ ��f X , 7 From: Reese <reese@webtechmine.com> Y : Message-ID: <CAAthfQsfZ4AdD-Zk0zLwSWcG_MHy12PAiHBu7zwAsFE4ZaX88g@mail.gmail.com> 1 ; Subject: About your bcmuslimgolfers.com. U = Content-Type: multipart/alternative; boundary="000000000000a2d578061e83371e" . 8 Date: Tue, 30 Jul 2024 21:06:22 -0700 V Return-Path: <reese@webtechmine.com> Return-path: <reese@webtechmine.com> . 6 Sender: Reese <reese@webtechmine.com> , < To: Info <info@bcmuslimgolfers.com> � A � � � c H � W Z w � 0 H � V Y d � ? � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1703 48 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 4771 63 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000a2d578061e83371e") NIL NIL NIL �/ q��f � W % From: "=?UTF-8?B?TWV0YU1hc2sgUG9ydGZvbGlv?=" <supports@caraccidentscenter.com> M ) Message-ID: <20240806012028.23E596745B8E4E11@caraccidentscenter.com> Z ' Subject: =?UTF-8?B?WW91ciBEZWNlbnRyYWxpemVkIGFjY291bnRzIHdpbGwgYmUgc3VzcGVuZGVk?= 4 - Content-Transfer-Encoding: quoted-printable 7 + Content-Type: text/html; charset="iso-8859-1" ( ( Date: 6 Aug 2024 01:20:28 +0000 j Return-Path: <supports@caraccidentscenter.com> Return-path: <supports@caraccidentscenter.com> % & To: info@bcmuslimgolfers.com ( H j � � t � Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 5236 168 NIL NIL NIL NIL 6) �z�f � 8 From: Rolex <ngvmpqoaszwn7rwdwqe@a.jjsd4fuj.ru> A Message-ID: <05F593FB0B32062E6A4D98A78A7804B6@opoepxvav> b U Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_c1f87b024a9d5724_=----" - Date: Fri, 9 Aug 2024 07:08:39 -0800 n Return-Path: <ngvmpqoaszwn7rwdwqe@a.jjsd4fuj.ru> Return-path: <ngvmpqoaszwn7rwdwqe@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A Z � < i H � X \ Z b H � W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 684 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_c1f87b024a9d5724_=----") NIL NIL NIL � #�f � F From: "Eduardo - Copy Trade" <extreme_forexea001@outlook.com> B Message-ID: <20240812014125.83F69DBEEDA8448C@outlook.com> O Subject: ***SPAM*** =?UTF-8?B?8J+UpSBTdGFydCBQcm9maXRpbmcgd2l0aCBDb3B5IEZvcmV4IC0gRVhUUkVNRSBIRURHRSBFQSBUb2RheSEg?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 12 Aug 2024 01:41:26 -0300 h Return-Path: <extreme_forexea001@outlook.com> Return-path: <extreme_forexea001@outlook.com> % To: info@bcmuslimgolfers.com ( H > � > _ ! Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1375 33 NIL NIL NIL NIL | ���f l 2 From: Rolex <sddytbejoouc7@a.jjsd4fuj.ru> ? Message-ID: <C3E995DE46E0FE706CA745B10F1859F7@eukplel> b T Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_00469b181efb6076_=----" . Date: Mon, 12 Aug 2024 01:13:37 -0800 b Return-Path: <sddytbejoouc7@a.jjsd4fuj.ru> Return-path: <sddytbejoouc7@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � % < i H ! X \ Z b H � W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 684 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_00469b181efb6076_=----") NIL NIL NIL fĹf � F From: "Eduardo - Copy Trade" <extreme_forexea001@outlook.com> B Message-ID: <20240813023445.49FD9187D18317BA@outlook.com> � Q Subject: ***SPAM*** =?UTF-8?B?8J+SpSBVbmxvY2sgSGlnaCBSZXR1cm5zIHdpdGggQ29weSBGb3JleCAtIEVYVFJFTUUgSEVER0UgRUEgLSAxMDAlIEZSRUUhIPCfkqU=?= 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 13 Aug 2024 02:34:46 -0300 h Return-Path: <extreme_forexea001@outlook.com> Return-path: <extreme_forexea001@outlook.com> % To: info@bcmuslimgolfers.com ( H � 7 Y " Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1369 34 NIL NIL NIL NIL � ��f h 9 From: DocuSign NA3 System <dse_NA4@docusign.net> C Message-ID: <20240813144612.8C3B161FA190A5C8@docusign.net> � C Subject: ***SPAM*** =?UTF-8?B?Q29tcGxldGVkOiBBY3Rpb24gTmVlZGVkOiBSZXF1ZXN0IDAxMyDigJMgU2lnbmF0dXJlIG5lZWRlZCBmb3IgeW91ciBjb250cmFjdHVhbCBkb2N1bWVudHMgJiBvcGVuIGludm9pY2VzIGZvciBwYXltZW50IA==?= _ Content-Type: multipart/related; boundary="----=_NextPart_000_0012_17D8EB6E.98E4EC40" ) Date: 13 Aug 2024 14:46:12 +0300 T Return-Path: <dse_NA4@docusign.net> Return-path: <dse_NA4@docusign.net> % To: info@bcmuslimgolfers.com � A � �_ 2a H \ ` 4: ; � @ �I } � P � @ �] y } = v � ("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 15114 214 NIL NIL NIL NIL)("image" "png" ("name" "logo-ds-116x33@2x.png") "<logo-ds-116x33@2x.png>" NIL "base64" 5012 NIL NIL NIL NIL)("image" "png" ("name" "docinvite-white.png") "<docinvite-white.png>" NIL "base64" 4214 NIL NIL NIL NIL) "related" ("boundary" "----=_NextPart_000_0012_17D8EB6E.98E4EC40") NIL NIL NIL �n �G�f \ 4 # From: James Cooper <james@marketingman.biz> P % Message-ID: <SCF3eWc6d7HpM9sU3zgbHQrkDZYQC9XpGfm0pJ2Y@marketingman.biz> : ` Subject: ***SPAM*** PCXLeads.com shutting down. * ) Content-Transfer-Encoding: base64 / ( Content-Type: text/html; charset=UTF-8 . ! Date: Thu, 15 Aug 2024 17:41:35 +0200 : $ Reply-To: "PCXLeads.com" <james@marketingman.biz> X Return-Path: <james@marketingman.biz> Return-path: <james@marketingman.biz> % " To: info@bcmuslimgolfers.com ( H � � � � H "text" "html" ("charset" "UTF-8") NIL NIL "base64" 402 7 NIL NIL NIL NIL �(�f � . From: Rolex <infosurly@h.liargay.net> � Message-ID: <8874633300819284625168.408655663538076-nf7uors62jnuq1gehl4.uh26mvbzyqwahlatdkgd9.3791621715986647471.olvrcpub@d5f4g6er5t548ht4r5hrtom> I > Subject: ***SPAM*** Luxury Watches on Sale - Starting at $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1255" . Date: Sat, 17 Aug 2024 02:19:16 +0630 Z Return-Path: <infosurly@h.liargay.net> Return-path: <infosurly@h.liargay.net> , To: info <info@bcmuslimgolfers.com> ( H � �8 b9 h Q "text" "html" ("charset" "windows-1255") NIL NIL "8bit" 14690 104 NIL NIL NIL NIL �E t��f h 0 From: Rolex <aprayawp9ee@a.jjsd4fuj.ru> A Message-ID: <3881470BF8405EAC498D6F5E7043B5DA@aalvwlxqs> b R Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_635b7a7e3a60e447_=----" . Date: Mon, 19 Aug 2024 19:16:00 -0800 ^ Return-Path: <aprayawp9ee@a.jjsd4fuj.ru> Return-path: <aprayawp9ee@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A [ � < i H � X \ Z b H � W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 684 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_635b7a7e3a60e447_=----") NIL NIL NIL � ���f � 7 From: Hottest Rolex <Jew@kk.hentai-sites.net> � Message-Id: <UUJSX3RUPRVU5IVIRMSISJNGHQRRA12Q.ALLEE.E47ZEKCEJ4JLWDX2.AI2RRV4HQLOJ.09912492101.GBZ0FGKF8XKJA9@194.146.38.9.hentai-sites.net> E Subject: Top Watches on Sale for a Limited Time - Only $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="Windows-1252" . Date: Thu, 22 Aug 2024 10:06:03 +0630 Z Return-Path: <Jew@kk.hentai-sites.net> Return-path: <Jew@kk.hentai-sites.net> , To: info <info@bcmuslimgolfers.com> ( H � � 0K �K � Q "text" "html" ("charset" "Windows-1252") NIL NIL "8bit" 19396 148 NIL NIL NIL NIL �W `��f � 9 From: Rolex <bsplvp30z3hwmqiucvws@a.jjsd4fuj.ru> = Message-ID: <290260A3349555252FEAE6058D117B49@auked> b R Subject: ***SPAM*** Rolex Watches Up To 90% Off! Top Quality Low Cost! Shop Online Now! Z Content-Type: multipart/alternative; boundary="----=_001_0cc263fe98991c27_=----" . Date: Thu, 22 Aug 2024 00:44:22 -0800 p Return-Path: <bsplvp30z3hwmqiucvws@a.jjsd4fuj.ru> Return-path: <bsplvp30z3hwmqiucvws@a.jjsd4fuj.ru> , To: info <info@bcmuslimgolfers.com> X-Priority: 3 � A � � < i H � X \ Z b H � W [ � � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 98 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 684 21 NIL NIL NIL NIL) "alternative" ("boundary" "----=_001_0cc263fe98991c27_=----") NIL NIL NIL � ���f ` ; From: "Standard Chartered Bank" <AdvicesMY@sc.com> ? ! Message-Id: <20240822101554.8DE6AA0080C@mail.tanex.ro> J M Subject: ***SPAM*** SUBJECT:Advice from Standard Chartered Bank N Content-Type: multipart/mixed; boundary="===============0316841148==" . Date: Thu, 22 Aug 2024 12:19:01 +0200 L Return-Path: <AdvicesMY@sc.com> Return-path: <AdvicesMY@sc.com> * To: Recipients <AdvicesMY@sc.com> � A � G 8� � A J _ b � H � � � � 5 H Y � � � � A @ �. � � �q �� � (("text" "plain" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 2323 53 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 5094 65 NIL NIL NIL NIL) "alternative" ("boundary" "===============1139351914==") NIL NIL NIL)("application" "octet-stream" NIL NIL NIL "base64" 958886 NIL ("attachment" ("filename" "SC_TR11670000_pdf.rar")) NIL NIL) "mixed" ("boundary" "===============0316841148==") NIL NIL NIL 1� )�f ( - From: Ray Ban <ends@open.bellay.net> P Message-ID: <C0HHDYACU1-EDLSUMCUDHUUGO-YTV-EBPV5-LSCFA@open.bellay.net> A Subject: Top Sunglasses Starting at $27.99 - Shop Today! ( Content-Transfer-Encoding: 8bit 3 Content-Type: text/html; charset="koi8-u" . Date: Fri, 23 Aug 2024 00:43:35 +1100 T Return-Path: <ends@open.bellay.net> Return-path: <ends@open.bellay.net> , To: info <info@bcmuslimgolfers.com> ( H � � �+ O, e K "text" "html" ("charset" "koi8-u") NIL NIL "8bit" 11343 101 NIL NIL NIL NIL t8 �@�f T ; From: "Marko Sandals" <markosandals2022@gmail.com> @ Z Subject: ***SPAM*** AVAILABLE FUNDS FOR INVESTMENT !! 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/plain; charset="iso-8859-1" . Date: Sat, 24 Aug 2024 05:23:04 -0700 - Reply-To: markosandals5050@gmail.com ` Return-Path: <markosandals2022@gmail.com> Return-path: <markosandals2022@gmail.com> 4 To: Recipients <markosandals2022@gmail.com> ( H r � � i "text" "plain" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 929 29 NIL NIL NIL NIL � ���f ` 1 From: Hot Rolex <muminfo@z.lambrian.net> v Message-ID: <rpgf5x2uqx.bhoeupjujo-efio9v3ngs.akpbk4mhcf-dephr8icp5x.ulr5d2hhwn@54sd5f.hgasdfhy.lambrian.net> < Subject: Top Watches Starting at $250 - Shop Today! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" . Date: Wed, 28 Aug 2024 19:18:42 +0630 X Return-Path: <muminfo@z.lambrian.net> Return-path: <muminfo@z.lambrian.net> , To: info <info@bcmuslimgolfers.com> ( H N � �3 K4 d Q "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 13387 100 NIL NIL NIL NIL 5@ � �f h D From: "=?UTF-8?B?TWV0YU1hc2s=?=" <info@furyauto.cloudns.be> J Message-ID: <20240828114226.E5EDD73E22CBA47B@furyauto.cloudns.be> R Subject: =?UTF-8?B?WW91ciBNZXRhTWFzayB3YWxsZXQgd2lsbCBiZSBzdXNwZW5kZWQu?= 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 28 Aug 2024 11:42:26 -0700 \ Return-Path: <info@furyauto.cloudns.be> Return-path: <info@furyauto.cloudns.be> % To: info@bcmuslimgolfers.com ( H � S H � � Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 5366 174 NIL NIL NIL NIL F& �o�f � E % From: "=?UTF-8?B?TWV0YU1hc2s=?=" <zowjni@zowjni.jadara.work> I ( Message-ID: <20240828115330.D9C57DCCB9D6B07F@zowjni.jadara.work> g l Subject: ***SPAM*** =?UTF-8?B?QXR0ZW1wdGVkIHVuYXV0aG9yaXplZCBhY2Nlc3MgdG8geW91ciBhY2NvdW50?= 4 , Content-Transfer-Encoding: quoted-printable 7 * Content-Type: text/html; charset="iso-8859-1" ) ' Date: 28 Aug 2024 11:53:30 -0700 ^ Return-Path: <zowjni@zowjni.jadara.work> Return-path: <zowjni@zowjni.jadara.work> % & To: info@bcmuslimgolfers.com ( H ! � �U �V @ [ "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 22265 320 NIL NIL NIL NIL �l [r�f � ; From: Discount Watches <infovalue@holidayrent.net> b Message-ID: <AC29146282205IG8PWITSHNRWV7qnrft_qit_ebs2c@flowdfkjghkwjehbtr.jsdakyfuiewrt> Y Subject: Luxurious Affordability: Top Luxury Watches on Sale - Starting at $250! 4 Content-Transfer-Encoding: Quoted-Printable 2 Content-Type: text/html; charset="utf-8" - Date: Mon, 2 Sep 2024 01:56:25 +0630 ^ Return-Path: <infovalue@holidayrent.net> Return-path: <infovalue@holidayrent.net> , To: info <info@bcmuslimgolfers.com> ( H D � 7 /8 " V "text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 14383 290 NIL NIL NIL NIL QC ��f � 2 From: WeTransfer <noreply@wetransfer.com> E Message-ID: <20240902231922.6BF50FA58FE3B712@wetransfer.com> 2 L Subject: ***SPAM*** You have 1 new file _ Content-Type: multipart/related; boundary="----=_NextPart_000_0012_41766A51.1ADF3449" ) Date: 02 Sep 2024 23:19:22 +0300 X Return-Path: <noreply@wetransfer.com> Return-path: <noreply@wetransfer.com> % To: info@bcmuslimgolfers.com � A � ( �a fc H \ ` �S bU � @ Xd � � � & � ("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 21858 411 NIL NIL NIL NIL)("image" "png" ("name" "blue2x-10b63a7e9107c08c8d89a3f8016c133ae4fcf5afb3e59a65fb17e21eeb83148d.png") "<blue2x-10b63a7e9107c08c8d89a3f8016c133ae4fcf5afb3e59a65fb17e21eeb83148d.png>" NIL "base64" 3110 NIL NIL NIL NIL) "related" ("boundary" "----=_NextPart_000_0012_41766A51.1ADF3449") NIL NIL NIL lq �/�f � = From: BOOM OF SALES <uazve@westpointdevelopment.com> H Message-ID: <ffefd58c-ac3a-4e4c-9cae-6b89b11ce6c6@DC.WPD.LOCAL> A C Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Tue, 3 Sep 2024 09:39:02 +0800 h Return-Path: <uazve@westpointdevelopment.com> Return-path: <uazve@westpointdevelopment.com> " To: <info@thedroppit.com> 0 ( H � � > � �h�f � @ From: BOOM OF SALES <xitcafdx@westpointdevelopment.com> H Message-ID: <68113843-f4db-4535-99e0-c1c8d7c9b3bd@DC.WPD.LOCAL> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Tue, 3 Sep 2024 09:39:38 +0800 n Return-Path: <xitcafdx@westpointdevelopment.com> Return-path: <xitcafdx@westpointdevelopment.com> ' To: <info@bcmuslimgolfers.com> 0 ( H u � � > < i�f � @ From: BOOM OF SALES <mjsvngua@westpointdevelopment.com> H Message-ID: <03703dc9-fbe0-4924-ae42-e9b26c4285d8@DC.WPD.LOCAL> A F Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS ! Content-Type: text/plain - Date: Tue, 3 Sep 2024 09:44:51 +0800 n Return-Path: <mjsvngua@westpointdevelopment.com> Return-path: <mjsvngua@westpointdevelopment.com> # To: <info@fabrikaplus.com> 0 ( H o � � > 6 Vj�f � 6 7 From: Kyle Jones <kyle@aiwebdevelopments.com> Y : Message-ID: <CAG7TbcpSuvo_nYd84RqP1kmmtZ+gaBDAKFTpgmEtNy_b7mqA-A@mail.gmail.com> a ; Subject: Re:bcmuslimgolfers.com: Do you need help creating a digital marketing proposal? U = Content-Type: multipart/alternative; boundary="000000000000d8d00706216d66e7" - 8 Date: Thu, 5 Sep 2024 23:20:20 -0700 ` Return-Path: <kyle@aiwebdevelopments.com> Return-path: <kyle@aiwebdevelopments.com> 8 6 Sender: Kyle Jones <kyle@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A � t � H � W Z � � ( H � V Y � � 6 � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1482 40 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 3322 54 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000d8d00706216d66e7") NIL NIL NIL ** U��f | / From: Rolex <luncheonany@garanten.net> � Message-ID: <mizchojvqqx-pdxzovdnhcvryomsl.asqivpgkha.gpsydcobfaxyccs.atagsdrmnixvibv-fenaqvkuog.kmsjbxhxmj@d545487.jkgjgh> R ? Subject: ***SPAM*** Top Watches on Sale for a Limited Time - Only $250! ( Content-Transfer-Encoding: 8bit 8 Content-Type: text/html; charset="iso-8859-15" - Date: Sat, 7 Sep 2024 20:20:55 +0630 \ Return-Path: <luncheonany@garanten.net> Return-path: <luncheonany@garanten.net> , To: info <info@bcmuslimgolfers.com> ( H � 6 lJ �J � P "text" "html" ("charset" "iso-8859-15") NIL NIL "8bit" 19192 140 NIL NIL NIL NIL bW ~Z�f � 8 7 From: David Green <david@aiwebdevelopments.com> Y : Message-ID: <CALfL5uzjr3_co+C2N4sygMEDHvek4d_T+a6TacfFAiFS-zwMTw@mail.gmail.com> U ; Subject: Make sure your bcmuslimgolfers.com is crawl-able by search engines. U = Content-Type: multipart/alternative; boundary="000000000000cca1cb0621a7d5b0" - 8 Date: Sun, 8 Sep 2024 21:03:10 -0700 b Return-Path: <david@aiwebdevelopments.com> Return-path: <david@aiwebdevelopments.com> : 6 Sender: David Green <david@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A g � z! H ' W Z r � A H V Y \ � R � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1971 65 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 6318 82 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000cca1cb0621a7d5b0") NIL NIL NIL �6 �s�f | 5 From: Hottest Rolex <usually@repromatic.net> � Message-ID: <8fjtvpjc0jlfloc66cgkwnkxgeksj2yhw-5qcbmqezmmq.5lbwharjlkrqgvau3cinu.wykht4ldand.y@dfgk;uwoekrjtuisdfe.net> L > Subject: ***SPAM*** Luxury Watches Starting at $250 - Shop Today! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1257" . Date: Thu, 12 Sep 2024 01:40:35 +0630 X Return-Path: <usually@repromatic.net> Return-path: <usually@repromatic.net> , To: info <info@bcmuslimgolfers.com> ( H � ) �3 [4 d Q "text" "html" ("charset" "windows-1257") NIL NIL "8bit" 13403 100 NIL NIL NIL NIL �@ d��f . $ From: "Aris Team" <katiep@katiep.com> A ' Message-ID: <20240913124732.5EBE9894948ACEFF@katiep.com> 4 d Subject: ***SPAM*** We Received Your Data 4 + Content-Transfer-Encoding: quoted-printable 3 ) Content-Type: text/plain; charset="utf-8" ) & Date: 13 Sep 2024 12:47:32 +0200 N Return-Path: <katiep@katiep.com> Return-path: <katiep@katiep.com> % % To: info@bcmuslimgolfers.com ( H ' � � � f V "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 4597 102 NIL NIL NIL NIL �& ��f d / . From: "SUPER LIST" <jgiyvh@911.gob.hn> D 2 Message-Id: <20240915145630.2FB423E4F390@correo.911.gob.hn> C / Subject: Email lists 100% VALID - Any country in the world . 1 Date: Sun, 15 Sep 2024 07:56:41 -0700 N Return-Path: <jgiyvh@911.gob.hn> Return-path: <jgiyvh@911.gob.hn> % 0 To: info@bcmuslimgolfers.com 0 ( ! � � % ��f | 0 From: Ray Ban <establish@d.talhost.net> J Message-ID: <omvptfiov6.891192892235814.hae3jtx5xbvx@talhost.net> W < Subject: ***SPAM*** Top Sunglasses on Sale for a Limited Time - Only $27.99! � Content-Type: multipart/related; boundary="__==___bwoptvytfbm2ejfgqgfu5guufjqedrfsur4c4ppeekdzkb8ddfyxanogkvmzvhc6dqwwgphusbbek27ilveb9yx8nxwrirz4agijv____==__" . Date: Thu, 19 Sep 2024 14:49:33 +1100 Z Return-Path: <establish@d.talhost.net> Return-path: <establish@d.talhost.net> , To: info <info@bcmuslimgolfers.com> D A � � � A _ � � E a H } S W H [ R V # . H J @ � � � } � H x (("text" "plain" ("charset" "windows-1255") NIL NIL "8bit" 22 3 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1255") NIL NIL "8bit" 302 11 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___kcq3axpf99tvaxmumujwk6bzyiyknlmepnntqvxoloafwr0iylsscnvchmqbd35jxgj6mn5vaj0ijkukmsifdpqmw1yzvloz7lq8m____==__") NIL NIL NIL)("image" "gif" ("name" "vmh.gif") "<7301711196179760170727438948083459699159879570682486445355986553794773087684773029284607543916854852>" NIL "base64" 2202 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "related" ("boundary" "__==___bwoptvytfbm2ejfgqgfu5guufjqedrfsur4c4ppeekdzkb8ddfyxanogkvmzvhc6dqwwgphusbbek27ilveb9yx8nxwrirz4agijv____==__") NIL NIL NIL y ���f x = From: Rolex Watches <infokingdom@emporiovirtual.net> m Message-ID: <8kgc3zmzona6sarl-rbd5idwn-taxa-ikul-bsmg-5sfvngc3tpxra8k-000000@khihkuyftrs.zonses.com> H Subject: Top Luxury Watches at Unbeatable Prices - Don't Delay! ( Content-Transfer-Encoding: 8bit 8 Content-Type: text/html; charset="iso-8859-13" . Date: Thu, 19 Sep 2024 18:47:58 +0630 h Return-Path: <infokingdom@emporiovirtual.net> Return-path: <infokingdom@emporiovirtual.net> , To: info <info@bcmuslimgolfers.com> ( H � � 7 �7 } P "text" "html" ("charset" "iso-8859-13") NIL NIL "8bit" 14234 125 NIL NIL NIL NIL �C ��f � 9 7 From: Njeri Devine <njeri@aiwebdevelopments.com> Y : Message-ID: <CAKfBoWyXA7J=2w3PgdoEXpKqdGmrMWDST-3AY5x2asMEDEKMWg@mail.gmail.com> U ; Subject: Make sure your bcmuslimgolfers.com is crawl-able by search engines. U = Content-Type: multipart/alternative; boundary="00000000000045a4ec0623258263" . 8 Date: Fri, 27 Sep 2024 20:24:26 -0700 b Return-Path: <njeri@aiwebdevelopments.com> Return-path: <njeri@aiwebdevelopments.com> ; 6 Sender: Njeri Devine <njeri@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A Z � �" ?# H y W Z � C H � V Y � W � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 2056 67 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 6686 87 NIL NIL NIL NIL) "alternative" ("boundary" "00000000000045a4ec0623258263") NIL NIL NIL �8 w�f � ? From: Rolex Watches <mpcppmminus@g.fatburningmode.com> C Message-ID: <ISW4SQ2QFAD-M.VX8XPHAJB9I@fatburningmode.com> X H Subject: ***SPAM*** | www.6-rox.com | Top Watches on Sale - Starting at $250! � Content-Type: multipart/alternative; boundary="==----7btqmk1lzuqytyekbnefh3llifs6jleu4tkf8cyxqc5ufywkvqo93cgrvsss6z----=" - Date: Tue, 1 Oct 2024 08:26:23 +0630 l Return-Path: <mpcppmminus@g.fatburningmode.com> Return-path: <mpcppmminus@g.fatburningmode.com> , To: info <info@bcmuslimgolfers.com> � A Y � s � H � N R H E M Q � 0 F ("text" "plain" ("charset" "utf-8") NIL NIL "base64" 6 1 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "base64" 5424 70 NIL NIL NIL NIL) "alternative" ("boundary" "==----7btqmk1lzuqytyekbnefh3llifs6jleu4tkf8cyxqc5ufywkvqo93cgrvsss6z----=") NIL NIL NIL �% �V�f � 3 From: "SUPER LIST" <mnavvuqpaj@sbsevo.com> Q Message-Id: <202410020625.4926PCXO018762-4926PCXQ018762@mail.sbsevo.com> P 9 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Wed, 2 Oct 2024 14:25:13 +0800 V Return-Path: <mnavvuqpaj@sbsevo.com> Return-path: <mnavvuqpaj@sbsevo.com> % To: info@bcmuslimgolfers.com 0 ( � ! � $ � {�f � 8 7 From: Ashis Padhi <asish@aiwebdevelopments.com> Y : Message-ID: <CAL6wf2hpWXtrcR+HMab1_4OaSObNNF-L8vgAGQE0P6YQNfvXbQ@mail.gmail.com> N ; Subject: Re: Elevate Your Business with Luxulia's Premium Ethnic Wear U = Content-Type: multipart/alternative; boundary="000000000000d80d4d06239438ff" - 8 Date: Thu, 3 Oct 2024 08:29:35 -0700 b Return-Path: <asish@aiwebdevelopments.com> Return-path: <asish@aiwebdevelopments.com> : 6 Sender: Ashis Padhi <asish@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A � ? � � H � W Z � � - H V Y � � $ � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1756 45 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 2535 36 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000d80d4d06239438ff") NIL NIL NIL [( ���f h 2 - From: "BOOM OF SALES" <xppjh@bkrsgrp.com> C 0 Message-Id: <20241002014041.83DD83144C763@mx2.bkrsgrp.com> A ^ Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - / Date: Wed, 2 Oct 2024 09:41:26 +0800 N Return-Path: <xppjh@bkrsgrp.com> Return-path: <xppjh@bkrsgrp.com> % . To: info@bcmuslimgolfers.com 0 ( * � ` � 1 � �g � ; 7 From: Julia Williams <julia@aiwebdevelopments.com> Y : Message-ID: <CAGXx4AhN-m4AJ-S3xt=X_BG01=xMB9msm5TaGtezRwetuLuhfA@mail.gmail.com> U ; Subject: Make sure your bcmuslimgolfers.com is crawl-able by search engines. U = Content-Type: multipart/alternative; boundary="0000000000007fb9e106242ef929" . 8 Date: Fri, 11 Oct 2024 03:07:12 -0500 b Return-Path: <julia@aiwebdevelopments.com> Return-path: <julia@aiwebdevelopments.com> = 6 Sender: Julia Williams <julia@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A ] � � U! H | W Z � C H � V Y � + Q � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 2065 67 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 6187 81 NIL NIL NIL NIL) "alternative" ("boundary" "0000000000007fb9e106242ef929") NIL NIL NIL 7 ��g � 3 From: "SUPER LIST" <duoachjrcvo@gp519.com> L Message-ID: <DF34B18B-DFCC-41FC-B646-19A90A10D910@mail.chinagp.net> P = Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Sun, 6 Oct 2024 21:44:52 +0100 V Return-Path: <duoachjrcvo@gp519.com> Return-path: <duoachjrcvo@gp519.com> & To: media@klovermarketing.com 0 ( � � % � �g h = From: Hottest Rolex <nzjcgssialtitude@mertricks.com> v Message-ID: <wa7mn727ozi6vlroxif1bnsmhhshfu8hf-cnfcqiapmpl.fltcptkordsehgbndjkq4.q2ip9cc7pff.a@mertricks.com> R T Subject: ***SPAM*** Top Watches on Sale for a Limited Time - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1257" h Return-Path: <nzjcgssialtitude@mertricks.com> Return-path: <nzjcgssialtitude@mertricks.com> , To: info <info@bcmuslimgolfers.com> ( H s �6 �7 � S "text" "html" ("charset" "windows-1257") NIL NIL "base64" 14244 184 NIL NIL NIL NIL I ��g < < From: Rolex Watches <ycnxzyqlight pen@vulturre.com> c Message-ID: <jcwcfozr1dyir4ro-3b107cna-wwyz-xdnx-f9aj-zxqfg0nflzxxdno-000000@vulturre.com> U P Subject: ***SPAM*** Top Luxury Watches at Unbeatable Prices - Don't Delay! * Content-Transfer-Encoding: base64 2 Content-Type: text/html; charset="utf-8" ` Return-Path: <ycnxzyqlight@localhost.com> Return-path: <ycnxzyqlight@localhost.com> , To: info <info@bcmuslimgolfers.com> ( H � � r7 ,8 � L "text" "html" ("charset" "utf-8") NIL NIL "base64" 14380 186 NIL NIL NIL NIL I :/g � 7 From: "SUPER LIST" <tlpqfzpkdw@isdisadown.com> N Message-Id: <E1t1hwV-005Whi-Ku@usc5-srv1.relay.ahi.mail.usgovdod.com> P G Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 18 Oct 2024 09:02:39 +0100 ^ Return-Path: <tlpqfzpkdw@isdisadown.com> Return-path: <tlpqfzpkdw@isdisadown.com> & To: chefamerica2011@gmail.com 0 ( � � $ � Ng @ 5 From: Rolex <ybvntmyvssadness@das-wilde.com> R Message-ID: <947757446357.491774921203g7904060367967w6et54@das-wilde.com> U L Subject: ***SPAM*** Rolex Watches on Sale for a Limited Time - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1257" h Return-Path: <ybvntmyvssadness@das-wilde.com> Return-path: <ybvntmyvssadness@das-wilde.com> , To: info <info@bcmuslimgolfers.com> ( H S � �= �> � S "text" "html" ("charset" "windows-1257") NIL NIL "base64" 16034 207 NIL NIL NIL NIL &N Cg � B From: Discount Watches <kcassistance@lestaxisanglais.net> � Message-ID: <37n8kqan2jk1m8vswgd.n8hb6eyosk3jt8o6v3fynpojojjl5r5p4wdf1exogwuaclkvmdu21kgoyt637a6drxxww4fiihnmp6yszbvkjkbjtqdwsjdh8ov90tb72wpi6mah3c.bizecqu2k6p98.kbbc80odyeb71lf@lestaxisanglais.net> F M Subject: ***SPAM*** Top Watches on Sale - Starting at $250! * Content-Transfer-Encoding: base64 8 Content-Type: text/html; charset="windows-874" l Return-Path: <kcassistance@lestaxisanglais.net> Return-path: <kcassistance@lestaxisanglais.net> , To: info <info@bcmuslimgolfers.com> ( H � �I �J � R "text" "html" ("charset" "windows-874") NIL NIL "base64" 19166 247 NIL NIL NIL NIL �Z E-g d 7 ) From: Rahul Singh <rahulsinghseo7@hotmail.com> f . Message-ID: <TYZPR04MB671653B04B1F13AFB3DAA53B984B2@TYZPR04MB6716.apcprd04.prod.outlook.com> ' * Subject: RE: I can help you.. w h Content-Type: multipart/alternative; boundary="_000_TYZPR04MB671653B04B1F13AFB3DAA53B984B2TYZPR04MB6716apcp_" . - Date: Tue, 29 Oct 2024 13:16:39 +0000 ` Return-Path: <rahulsinghseo7@hotmail.com> Return-path: <rahulsinghseo7@hotmail.com> � A �) e* �& �' H * ^ a � � ' H V. ] ` �! -" � ( ("text" "plain" ("charset" "Windows-1252") NIL NIL "quoted-printable" 989 39 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "quoted-printable" 8749 169 NIL NIL NIL NIL) "alternative" ("boundary" "_000_TYZPR04MB671653B04B1F13AFB3DAA53B984B2TYZPR04MB6716apcp_") NIL ("en-US") NIL zP �� g < 4 From: "SUPER LIST" <mvrludve@fxdz05340.com> P : Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Mon, 21 Oct 2024 20:54:42 -0700 X Return-Path: <mvrludve@fxdz05340.com> Return-path: <mvrludve@fxdz05340.com> , To: christianberger@boomerangrp.com 0 ( T � I * s �k!g � 3 From: Rolex <bkzhhimkspiping@topideaz.com> � Message-ID: <h0cd4s2zdk.swoxbbnfxea6n1ajkwv2uqa007vt2981hj8nmyi53vqbvffyxt.6quu3wwv4zygww4lfxftbubrnokem3kaqulaqqfr0rgpqmqidz1@topideaz.com> C Subject: Top Luxury Watches Starting at $250 - Shop Today! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1253" - Date: Fri, 1 Nov 2024 01:17:59 +0630 d Return-Path: <bkzhhimkspiping@topideaz.com> Return-path: <bkzhhimkspiping@topideaz.com> , To: info <info@bcmuslimgolfers.com> ( H � � (, �, � S "text" "html" ("charset" "windows-1253") NIL NIL "base64" 11452 148 NIL NIL NIL NIL �9 �#g L 4 From: Hottest Rolex <ptrabbi@mertricks.com> v Message-ID: <98vyrsfhyeduvil6ddg25pytplrdyy4lk-y0wxh7yfcue.jhrfyreyzxbgxoozgl62m.m8wwp9ofqop.g@mertricks.com> R O Subject: ***SPAM*** Top Watches on Sale for a Limited Time - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1257" V Return-Path: <ptrabbi@mertricks.com> Return-path: <ptrabbi@mertricks.com> , To: info <info@bcmuslimgolfers.com> ( H � �6 �7 � S "text" "html" ("charset" "windows-1257") NIL NIL "base64" 14228 184 NIL NIL NIL NIL �G �z'g < : From: "BOOM OF SALES" <cxnqwwuvhld@fxdz05340.com> A > Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Thu, 24 Oct 2024 20:48:58 +0800 ^ Return-Path: <cxnqwwuvhld@fxdz05340.com> Return-path: <cxnqwwuvhld@fxdz05340.com> % To: info@bcmuslimgolfers.com 0 ( R � ` � 1 � |�'g � F From: Swiss Luxury Watches <wqzjveljopicky@202-webdesign.net> � Message-ID: <dhvjzkrlqkjo.sjqssbfdpoaf-kqhmskvlxfzkeaembjhkkbiqaiqbxae.hwaialfqjcrnwkz.mcdmveaafsijwbi.qdwpk.vjhew@202-webdesign.net> V Subject: Black Friday Deals 2024: Top Luxury Watches at Only $250 - Shop Now! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1255" - Date: Wed, 6 Nov 2024 01:21:04 +0630 l Return-Path: <wqzjveljopicky@202-webdesign.net> Return-path: <wqzjveljopicky@202-webdesign.net> , To: info <info@bcmuslimgolfers.com> ( H a � 2 �2 � S "text" "html" ("charset" "windows-1255") NIL NIL "base64" 12988 168 NIL NIL NIL NIL u@ Oi*g � % From: Rolex <olbs@iravi.net> � Message-ID: <SZQDD1IIJRMX3JK.A09HQU6C72FM0LCT2MNT74FGQUDGKJIEWJKTPWN0LP0KRG89SV9YPS9CCPFAGMJLI3XICWFIJB3K2VMU323FBSJFHEL5MZSAHRRICLQCC2KMLCKED14LREEQT1WPVQI3QVUBKXHYKYNA7WU66@mail.iravi.net> F Subject: Discount Designer Watches at Only $250 - Shop Today! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1256" - Date: Fri, 8 Nov 2024 18:09:56 +0630 H Return-Path: <olbs@iravi.net> Return-path: <olbs@iravi.net> , To: info <info@bcmuslimgolfers.com> ( H � � U1 �1 � S "text" "html" ("charset" "windows-1256") NIL NIL "base64" 12794 165 NIL NIL NIL NIL �> �-g \ : From: Top Luxury Bags <hahgroan@featureworld.net> B Message-ID: <2UWKZMZFEC_NWJPMLF7F7CVLNY@featureworld.net> W Subject: Black Friday 2024:Top Luxury Bags: Unbelievable Discount - Only $150! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1256" . Date: Sun, 10 Nov 2024 20:00:07 +1100 ^ Return-Path: <hahgroan@featureworld.net> Return-path: <hahgroan@featureworld.net> , To: info <info@bcmuslimgolfers.com> ( H � R6 7 � S "text" "html" ("charset" "windows-1256") NIL NIL "base64" 14088 182 NIL NIL NIL NIL D Tv0g \ 0 " From: "BOOM OF SALES" <wymgab@itsla.ru> ? % Message-Id: <20241109132312.3DE34430305@mail.itsla.ru> A I Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - $ Date: Sat, 9 Nov 2024 10:23:13 -0300 J Return-Path: <wymgab@itsla.ru> Return-path: <wymgab@itsla.ru> % # To: info@bcmuslimgolfers.com 0 ( � E ` � 1 [ c{0g � > From: Top Watches <ztpdkpzuaassociative@dans50th.com> � Message-ID: <ginweazww6m5en3dwzwrtl-vzt17dhpvc.wl8bvrf7t885.5mrwr0maotu4q2hsoh.uh9aj1xszigjcfz3mesbv@sdsdf56g74er65y486t.dans50th.com> Z B Subject: ***SPAM*** Luxury Watches on Sale - Unbelievable Discount - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1256" n Return-Path: <ztpdkpzuaassociative@dans50th.com> Return-path: <ztpdkpzuaassociative@dans50th.com> , To: info <info@bcmuslimgolfers.com> ( H ) l �D �E � S "text" "html" ("charset" "windows-1256") NIL NIL "base64" 17796 230 NIL NIL NIL NIL �R �~1g P ; From: Hot Rolex <eqyftparentheses@dermiracorp.net> l Message-ID: <vq9ls0mdfomohl5kx7mcdqlheoc6mlv79_doxsexfrhkvx9ufgmd9xalizaeisgwundqy@dermiracorp.net> K Subject: Black Friday:Top Luxury Watches for Just $250 - Shop Now! * Content-Transfer-Encoding: base64 8 Content-Type: text/html; charset="WINDOWS-1258" l Return-Path: <eqyftparentheses@dermiracorp.net> Return-path: <eqyftparentheses@dermiracorp.net> , To: info <info@bcmuslimgolfers.com> ( H � ? �0 :1 � S "text" "html" ("charset" "WINDOWS-1258") NIL NIL "base64" 12602 163 NIL NIL NIL NIL �> �@5g � 8 7 From: Kyla Stevens <kyla@aiwebdevelopments.com> Y : Message-ID: <CAAPmHAv6mQ4JZBzJsYJnuxi0RVBp1G1DWZsaRDRqOJxGgEEKbQ@mail.gmail.com> K ; Subject: Increase Your bcmuslimgolfers.com Traffic and Visibility. U = Content-Type: multipart/alternative; boundary="000000000000aeac7c0626f151ea" . 8 Date: Fri, 15 Nov 2024 02:49:17 -0800 ` Return-Path: <kyla@aiwebdevelopments.com> Return-path: <kyla@aiwebdevelopments.com> : 6 Sender: Kyla Stevens <kyla@aiwebdevelopments.com> , < To: Info <info@bcmuslimgolfers.com> � A d ( � H $ W Z N { - H � V Y � < � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1659 45 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 4616 60 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000aeac7c0626f151ea") NIL NIL NIL -/ a'7g $ 1 From: Hot Rolex <wcxceviable@dewahk.net> L Message-ID: <5743442121378OROOAZEFDCVFY5kuzqu_sq3_5ftxf@dewahk.net> Z G Subject: ***SPAM*** [Black Friday] Top Luxury Watches at an Unbelievable Price! * Content-Transfer-Encoding: base64 7 Content-Type: text/html; charset="WINDOWS-874" X Return-Path: <wcxceviable@dewahk.net> Return-path: <wcxceviable@dewahk.net> , To: info <info@bcmuslimgolfers.com> ( H � � - �- � R "text" "html" ("charset" "WINDOWS-874") NIL NIL "base64" 11674 151 NIL NIL NIL NIL �; $8g x 7 From: Top Watches <arurmksojourn@dans50th.com> � Message-ID: <fwv7yyacjhjqcajwm0tw6e-i1pd7xhrsf.wr4tadkmyv19.5py6avmwxpc0qk5xkx.jxhb9xtogqmrxtte90s1c@sdsdf56g74er65y486t.dans50th.com> Z A Subject: ***SPAM*** Luxury Watches on Sale - Unbelievable Discount - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1256" ` Return-Path: <arurmksojourn@dans50th.com> Return-path: <arurmksojourn@dans50th.com> , To: info <info@bcmuslimgolfers.com> ( H � �D zE � S "text" "html" ("charset" "windows-1256") NIL NIL "base64" 17786 229 NIL NIL NIL NIL iR �G>g , 3 From: "SUPER LIST" <ckiezfbzntt@gmail.com> P Y Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sat, 23 Nov 2024 08:53:27 +0700 V Return-Path: <ckiezfbzntt@gmail.com> Return-path: <ckiezfbzntt@gmail.com> To: john@scallo.com 0 ( � � $ � �5Ag ` 2 From: "BOOM OF SALES" <jhfoljv@gmail.com> C # Message-Id: <20241123073210.0558544511E3@mail2.conrep.com> A W Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Sat, 23 Nov 2024 04:08:02 -0300 N Return-Path: <jhfoljv@gmail.com> Return-path: <jhfoljv@gmail.com> To: sales@kestakon.com 0 ( � � ` � 1 � ��Ag � 7 ) From: Julie Salmo <JulieSalmo1963@outlook.com> f . Message-ID: <MN0PR19MB58738B66A5E3BDB8646042E4D22F2@MN0PR19MB5873.namprd19.prod.outlook.com> - * Subject: Re: Web Design Services...! w p Content-Type: multipart/alternative; boundary="_000_MN0PR19MB58738B66A5E3BDB8646042E4D22F2MN0PR19MB5873namp_" . - Date: Wed, 27 Nov 2024 06:22:08 +0000 g 6 In-Reply-To: <MN0PR19MB58737DD26BCFF7AF8B57E366D22E2@MN0PR19MB5873.namprd19.prod.outlook.com> � 0 References: <MN0PR19MB587340B4D86FC60BF71A80BAD25B2@MN0PR19MB5873.namprd19.prod.outlook.com> <MN0PR19MB58731F1367368A0B36180C47D2272@MN0PR19MB5873.namprd19.prod.outlook.com> <MN0PR19MB5873CD8E396B352854F193ECD2202@MN0PR19MB5873.namprd19.prod.outlook.com> <MN0PR19MB5873CDE02E8BC1997CD758FAD2212@MN0PR19MB5873.namprd19.prod.outlook.com> <MN0PR19MB58737DD26BCFF7AF8B57E366D22E2@MN0PR19MB5873.namprd19.prod.outlook.com> ` Return-Path: <JulieSalmo1963@outlook.com> Return-path: <JulieSalmo1963@outlook.com> � A �+ E, J � H �+ \ _ j u H �- [ ^ e � ! # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 373 11 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1414 33 NIL NIL NIL NIL) "alternative" ("boundary" "_000_MN0PR19MB58738B66A5E3BDB8646042E4D22F2MN0PR19MB5873namp_") NIL ("en-US") NIL �3 ǺFg 0 7 " From: "BOOM OF SALES" <npcyns@mycensus.gov.my> A J Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . $ Date: Tue, 26 Nov 2024 13:12:05 +0700 X Return-Path: <npcyns@mycensus.gov.my> Return-path: <npcyns@mycensus.gov.my> & # To: admin@globalmoneylabs.com 0 ( � ` � 1 & � Gg $ : From: Luxury Watches <slevasion@movielicious.net> d H Subject: ***SPAM*** Black Friday - Luxury Watches on Sale for a Limited Time - Only $250! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1256" - Date: Fri, 2 Dec 2024 26:22:12 +0000 ` Return-Path: <slevasion@movielicious.net> Return-path: <slevasion@movielicious.net> , To: info <info@bcmuslimgolfers.com> ( H � 5 i, �, � S "text" "html" ("charset" "windows-1256") NIL NIL "base64" 11518 149 NIL NIL NIL NIL U; [aHg P 8 From: Walsh Philip <Walsh.philip@natwest.co.uk> D Message-ID: <20241128182726.780095C7DD558CC9@natwest.co.uk> * L Subject: ***SPAM*** MY PROPOSAL 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 28 Nov 2024 18:27:26 -0800 ) Reply-To: taofei6666@hotmail.com ` Return-Path: <Walsh.philip@natwest.co.uk> Return-path: <Walsh.philip@natwest.co.uk> % To: info@bcmuslimgolfers.com ( H � � T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 534 17 NIL NIL NIL NIL � �&Ig d 1 From: "SUPER LIST" <nhfabmqiy@gmail.com> 9 Message-Id:<67494A1B.D93AAC.13427@hexinpass.com> P R Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 29 Nov 2024 11:58:24 +0700 R Return-Path: <nhfabmqiy@gmail.com> Return-path: <nhfabmqiy@gmail.com> To: john@scallo.com 0 ( � 1 � % � KJIg l 7 & From: Luxury Bags <consumezobqizpev@icjekr.ru> b % Message-ID: <RLBBL7BZVTHE.ZTRTUOCVA883.08BRKKDJQ9I4Q2BCX8LDHQB0H8CW1HG0S9Xzz@z.icjekr.ru> R ( Subject: Black Friday 2024:Luxury Bags at Unbeatable Prices - Don't Wait! * , Content-Transfer-Encoding: base64 5 * Content-Type: text/html; charset="us-ascii" . $ Date: Thu, 11 Nov 2025 20:32:00 +0000 ` Return-Path: <consumezobqizpev@icjekr.ru> Return-path: <consumezobqizpev@icjekr.ru> , ' To: info <info@bcmuslimgolfers.com> ( H j � I1 �1 � O "text" "html" ("charset" "us-ascii") NIL NIL "base64" 12782 165 NIL NIL NIL NIL �A EKg � 9 From: Saumya Contact <contacts@global-medic.pro> G Message-ID: <20241202092514.51791C53F9CE527C@global-medic.pro> H Z Subject: ***SPAM*** Re: Business Collaboration Opportunity!! 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 02 Dec 2024 09:25:14 -0800 ; Reply-To: Saumya Contact <contact@saumya-mail.com> ^ Return-Path: <contacts@global-medic.pro> Return-path: <contacts@global-medic.pro> % To: info@bcmuslimgolfers.com ( H k � T c X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 867 15 NIL NIL NIL NIL � ��Mg 0 7 From: "BOOM OF SALES" <gcyjhgldqe@ateamid.com> A > Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Mon, 2 Dec 2024 20:47:25 +0700 X Return-Path: <gcyjhgldqe@ateamid.com> Return-path: <gcyjhgldqe@ateamid.com> & To: admin@globalmoneylabs.com 0 ( \ � ` � 1 � �Ng � 9 From: Hot Rolex <jiadriieodour@justkitchens.net> � Message-ID: <rn8tyukosqkhjqoidjo874fvkbppch1tqpezxm4gfctrnplddnrafdbhqfwj4len9dwvjqmsvpnjmbufwwqgy7uidnwbjyu2olbgwe1v3ievsmppp-digqpni17zetorp@justkitchens.net> M " Subject: [Black Friday] Top Luxury Watches for Just $250 - Shop Now! * % Content-Transfer-Encoding: base64 7 $ Content-Type: text/html; charset="WINDOWS-874" - Date: Sat, 12 Nov 2025 11:1111 +0000 h Return-Path: <jiadriieodour@justkitchens.net> Return-path: <jiadriieodour@justkitchens.net> , ! To: info <info@bcmuslimgolfers.com> ( H f � 1 �1 � R "text" "html" ("charset" "WINDOWS-874") NIL NIL "base64" 12730 165 NIL NIL NIL NIL {@ ԅNg ( 3 From: "BOOM OF SALES" <qujtbo@silk.org.tw> A = Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Fri, 6 Dec 2024 15:11:48 -0300 P Return-Path: <qujtbo@silk.org.tw> Return-path: <qujtbo@silk.org.tw> * To: contact@afitechconsulting.com 0 ( � ` � 1 5 �oSg l 3 ! From: "BOOM OF SALES" <gewui@visistat.com> M $ Message-Id: <20241118161957.8666D9BCE90@209-128-119-146.bayarea.net> A J Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . # Date: Mon, 18 Nov 2024 08:19:57 -0800 P Return-Path: <gewui@visistat.com> Return-path: <gewui@visistat.com> " To: arsnavley@gmail.com 0 ( � ` � 1 Ug X 0 From: "SUPER LIST" <vgaudosd@gmail.com> 4 Message-Id:<6755FB0A.60FD4B.27750@hbtec.cn> P P Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Tue, 26 Nov 2024 04:46:53 +0800 P Return-Path: <vgaudosd@gmail.com> Return-path: <vgaudosd@gmail.com> To: info@nzebtech.com 0 ( a � K + � 9�Ug x A From: "Boost Your Sales" <boost-sales-today@outlook.com> B Message-ID: <20241209000559.34956E2C68AB05BB@outlook.com> e K Subject: ***SPAM*** Reach Customers Now: Just Like I Reached You, You Can Reach Thousands! 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ( Date: 9 Dec 2024 00:05:59 -0300 f Return-Path: <boost-sales-today@outlook.com> Return-path: <boost-sales-today@outlook.com> % To: info@bcmuslimgolfers.com ( H < � h � ! X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 905 33 NIL NIL NIL NIL � �^Vg 1 From: "BOOM OF SALES" <mqtkdjwo@bx6.top> A I Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 13 Nov 2024 18:40:49 -0300 L Return-Path: <mqtkdjwo@bx6.top> Return-path: <mqtkdjwo@bx6.top> ! To: nays@www.sisofom.com 0 ( a ` � 1 w o(Yg l 5 # From: Luis Ferreira <luis@windowstuneup.com> T % Message-ID: <tPasvwtqLEaN6HOHcZoWMOeZ5BIYxPtWcVWy728hfS4@windowstuneup.com> > a Subject: ***SPAM*** PCX Group.com Earn $10K a month * ) Content-Transfer-Encoding: base64 / ( Content-Type: text/html; charset=UTF-8 . ! Date: Thu, 12 Dec 2024 10:07:50 +0300 : $ Reply-To: "PCXGroup.com" <luis@windowstuneup.com> X Return-Path: <luis@windowstuneup.com> Return-path: <luis@windowstuneup.com> % " To: info@bcmuslimgolfers.com ( H � ? z � I "text" "html" ("charset" "UTF-8") NIL NIL "base64" 644 10 NIL NIL NIL NIL W .�Zg � 8 From: "SUPER LIST" <gmoltvrcfcs@platform-md.ru> E Message-Id: <20241215144625.640541FCF70@mail.platform-md.ru> P > Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sun, 15 Dec 2024 22:46:26 +0800 ` Return-Path: <gmoltvrcfcs@platform-md.ru> Return-path: <gmoltvrcfcs@platform-md.ru> To: info@pkbiotec.com 0 ( J I * * <_g l 4 From: "BOOM OF SALES" <ymbabtiemm@cnk8.com> B Message-Id: <20241210070533.CE542346B5702@mail.lshou.com> A A Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Mon, 18 Nov 2024 13:21:29 -0300 R Return-Path: <ymbabtiemm@cnk8.com> Return-path: <ymbabtiemm@cnk8.com> ' To: info@mncscreenprinting.com 0 ( � � ` � 1 ũbg @ 4 From: "SUPER LIST" <kfekfdfsa@codecate.com> P 8 Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Tue, 17 Dec 2024 05:04:23 +0900 X Return-Path: <kfekfdfsa@codecate.com> Return-path: <kfekfdfsa@codecate.com> - To: jacob.keane.vaba65@statefarm.com 0 ( � � I * � ��ig H : ) From: Meera Kumari <meerakumari.la30@outlook.com> f / Message-ID: <SN7PR14MB74439F8E9F7949DD67D43E3D8B0D2@SN7PR14MB7443.namprd14.prod.outlook.com> ( + Subject: Re: Send Please report w x Content-Type: multipart/alternative; boundary="_000_SN7PR14MB74439F8E9F7949DD67D43E3D8B0D2SN7PR14MB7443namp_" . . Date: Thu, 26 Dec 2024 16:04:11 +0000 g ? In-Reply-To: <SN7PR14MB74437DDB9EC7E4FD9AF6658F8B0C2@SN7PR14MB7443.namprd14.prod.outlook.com> > 1 References: <DS7PR12MB82506FDACD4EAD34C165A62F8BB32@DS7PR12MB8250.namprd12.prod.outlook.com> <DS7PR12MB825025B379D719D9A8948BFB8BBD2@DS7PR12MB8250.namprd12.prod.outlook.com> <DS7PR12MB8250336FC7B3CC52188B8C818BBA2@DS7PR12MB8250.namprd12.prod.outlook.com> <DS7PR12MB825035C497124FC8B52AC5008B852@DS7PR12MB8250.namprd12.prod.outlook.com> <DS7PR12MB82501A0F3D943F9853A52B778B872@DS7PR12MB8250.namprd12.prod.outlook.com> <SN7PR14MB7443C646AE271742B55ABE738B052@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB74432A5CEEADF70223C935B58B062@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB7443FD7A8A6EC55305499FB78B072@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB74431936339D464A97E69FD38B002@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB7443C9792189129A290656908B012@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB74435BDBAB4ABBE9C338B27D8B022@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB74431AD4716CE6FAB5EE2A788B032@SN7PR14MB7443.namprd14.prod.outlook.com> <SN7PR14MB74437DDB9EC7E4FD9AF6658F8B0C2@SN7PR14MB7443.namprd14.prod.outlook.com> d Return-Path: <meerakumari.la30@outlook.com> Return-path: <meerakumari.la30@outlook.com> 8 * To: Meera Kumari <meerakumari.la30@outlook.com> � A - �- � � H A- \ _ � � H |. [ ^ p � : # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 170 12 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2474 58 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SN7PR14MB74439F8E9F7949DD67D43E3D8B0D2SN7PR14MB7443namp_") NIL ("en-US") NIL �8 �~mg t T From: Top Luxury Watches Only $250 <pdemprevision@o.b.b.kandmsolutions.net> C Message-Id: <5E07F46F-E604-4710-9A65-6B14AD893209@mac.com> F N Subject: ***SPAM*** Unveil Luxury: Premium Watches at $250! ( # Content-Transfer-Encoding: 8bit 9 ! Content-Type: text/html; charset="windows-1255" . Date: Fri, 27 Dec 2024 18:29:34 +0000 x Return-Path: <pdemprevision@o.b.b.kandmsolutions.net> Return-path: <pdemprevision@o.b.b.kandmsolutions.net> , To: info <info@bcmuslimgolfers.com> ( H � � = � P "text" "html" ("charset" "windows-1255") NIL NIL "8bit" 4925 149 NIL NIL NIL NIL [$ �pg � F " From: $250 Luxury Watches <xbijbanqtuberculosis@momopoly.net> v Message-ID: <81b7fd6f998598e583c007d4b.549ba6201a.20241224201505.8d0cb09e02.7a341244@mail170.atl21.rsgsv.net> � ] Subject: ***SPAM*** =?windows-1256?B?RGlzY292ZXIgT3VyIEV4Y2x1c2k=?= =?windows-1256?B?dmUgTHV4dXJ5IFdhdGNoZXMgliA=?= =?windows-1256?B?T25seSAkMjUwIQ==?= ( ' Content-Transfer-Encoding: 8bit 9 % Content-Type: text/html; charset="windows-1256" . Date: Tue, 24 Dec 2024 20:15:17 +0000 n Return-Path: <xbijbanqtuberculosis@momopoly.net> Return-path: <xbijbanqtuberculosis@momopoly.net> , # To: info <info@bcmuslimgolfers.com> ( H � U � � G O "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 2504 71 NIL NIL NIL NIL v �ug T 5 From: Luxury Bags <decimaljsrxnpxg@5igy.net> n Message-ID: <list-jrparis.netBXSEJ1OSLUYZ.4GDAPHB1L6DQ471WVORL-J0QEWTCBCOHE7WAGKOPURR.80WAX@5igy.net> B T Subject: ***SPAM*** Exclusive Luxury Bags at Only $200! ( " Content-Transfer-Encoding: 8bit 2 Content-Type: text/html; charset="utf-8" - Date: Sat, 4 Jan 2025 13:10:53 +0630 \ Return-Path: <decimaljsrxnpxg@5igy.net> Return-path: <decimaljsrxnpxg@5igy.net> , To: info <info@bcmuslimgolfers.com> ( H � � ) H "text" "html" ("charset" "utf-8") NIL NIL "8bit" 2857 31 NIL NIL NIL NIL � 1�xg $ 9 $ From: Luxury Watches <artwqh@weightlosspals.net> � Message-ID: <SPMTO4I4SQC2GGYBZNEFBK5T7I8GXHTSV834P0H20MVCBNJ5X9USI4E7YVDUL6SKOXP3GW6OLM38ZGVGOVIH6KXT9NV8R6UQCYHU-EYBUXEVZAJVXSDFJBYUD4ROS8366YPE0CHCGWMXVCTUFIXPKTE@weightlosspals.net> l ^ Subject: ***SPAM*** Explore Our Luxury Watch Collection Now! Get Your Luxury Watch for Only $250! 4 ( Content-Transfer-Encoding: Quoted-Printable 8 ' Content-Type: text/html; charset="WINDOWS-1257" X Date: Fri, 19 Dec 2024 12:21:22 +0000 Date: Tue, 24 Dec 2024 00:59:23 +0000 ^ Return-Path: <artwqh@weightlosspals.net> Return-path: <artwqh@weightlosspals.net> , % To: info <info@bcmuslimgolfers.com> ( H | � W � , [ "text" "html" ("charset" "WINDOWS-1257") NIL NIL "Quoted-Printable" 1923 44 NIL NIL NIL NIL � <'zg M From: 250USD Luxury Watches <dtdsuzsapparently@m.m.lutoneglobal.net> ? U Subject: ***SPAM*** Timeless Luxury Watches for $250 ( # Content-Transfer-Encoding: 8bit 2 ! Content-Type: text/html; charset="utf-8" . Date: Wed, 18 Dec 2024 07:39:11 -0800 x Return-Path: <dtdsuzsapparently@m.m.lutoneglobal.net> Return-path: <dtdsuzsapparently@m.m.lutoneglobal.net> , To: info <info@bcmuslimgolfers.com> ( H W � h � I "text" "html" ("charset" "utf-8") NIL NIL "8bit" 4712 134 NIL NIL NIL NIL �# ��g � 8 From: "SUPER LIST" <pkxbgnvwz@careerhosts.site> Q Message-ID: <AA174B6C-9FC1-4FEB-BCBD-035A8A0269FE@mail.careerhosts.site> P > Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sun, 12 Jan 2025 08:24:46 +0700 ` Return-Path: <pkxbgnvwz@careerhosts.site> Return-path: <pkxbgnvwz@careerhosts.site> % To: info@bcmuslimgolfers.com 0 ( _ � % �r�g � = From: Luxury Watches <xpuquizzical@voicecasting.net> { Message-ID: <I8MNRGNVGX-2QPTSTJYUA-IVIXM2RHMP-IJFCHZ6LOZESBQY8MUDVXQALDBRDHSAET32W3ODKHMS7MDLQUV@voicecasting.net> P [ Subject: ***SPAM*** Luxury Watches Collection for You. $250 per Watch 4 % Content-Transfer-Encoding: Quoted-Printable 9 # Content-Type: text/html; charset="windows-1250" . Date: Mon, 23 Dec 2024 13:00:49 +0000 f Return-Path: <xpuquizzical@voicecasting.net> Return-path: <xpuquizzical@voicecasting.net> , ! To: info <info@bcmuslimgolfers.com> ( H 1 � ` � m \ "text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 3277 109 NIL NIL NIL NIL � E �g � : - From: "BOOM OF SALES" <postmaster@kawancicil.com> E 0 Message-Id: <20241120204917.9C34F16D6A1@mail.kawancicil.com> A f Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . / Date: Thu, 21 Nov 2024 03:49:17 +0700 ^ Return-Path: <postmaster@kawancicil.com> Return-path: <postmaster@kawancicil.com> & . To: admin@globalmoneylabs.com 0 ( a � ` � 1 � F�g ( 7 ) From: Mark Stones <Mark.stones145@outlook.com> e / Message-ID: <SL2P216MB244154B701193480987F9502C7EE2@SL2P216MB2441.KORP216.PROD.OUTLOOK.COM> 8 + Subject: Re: "Explore Affordable Web Solutions" w n Content-Type: multipart/alternative; boundary="_000_SL2P216MB244154B701193480987F9502C7EE2SL2P216MB2441KORP_" . . Date: Wed, 29 Jan 2025 12:48:53 +0000 f 5 In-Reply-To: <SL2P216MB2441D741B04EB64967986512C7EF2@SL2P216MB2441.KORP216.PROD.OUTLOOK.COM> 1 References: <PUWP216MB2447D07CA67768CDF0156D70C7E02@PUWP216MB2447.KORP216.PROD.OUTLOOK.COM> <SL2P216MB244128D4AFB367162CF9F153C7EC2@SL2P216MB2441.KORP216.PROD.OUTLOOK.COM> <SL2P216MB2441D741B04EB64967986512C7EF2@SL2P216MB2441.KORP216.PROD.OUTLOOK.COM> ` Return-Path: <Mark.stones145@outlook.com> Return-path: <Mark.stones145@outlook.com> F * To: "limetreedesigns@icloud.com" <limetreedesigns@icloud.com> � A ,* �* � H l* \ _ � � H �, [ ^ ~ � " # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 501 14 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 1440 34 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SL2P216MB244154B701193480987F9502C7EE2SL2P216MB2441KORP_") NIL ("en-IN") NIL 3 $�g p 3 From: "BOOM OF SALES" <qcogisag@1giay.net> H Message-ID: <7F23731E-358A-4FB8-AAD0-BE568FAF18DB@gmail.edu.vn> A ? Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Sun, 5 Jan 2025 00:04:22 +0800 P Return-Path: <qcogisag@1giay.net> Return-path: <qcogisag@1giay.net> ) To: khoangiengbaotrang@gmail.com 0 ( a � a � 2 � 做g � 7 " From: "SUPER LIST" <vexkrgqh@parhoon-tarh.com> = % Message-Id: <20250130231102.E876B2C1027@mail.pt.com> P M Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . $ Date: Fri, 31 Jan 2025 06:11:05 +0700 ^ Return-Path: <vexkrgqh@parhoon-tarh.com> Return-path: <vexkrgqh@parhoon-tarh.com> ' # To: info@radionuovasalerno.com 0 ( R � � $ > 쟜g X ? , From: "=?UTF-8?B?TWV0YU1hc2s=?=" <info@mrodeny.com.sa> E 0 Message-ID: <20250211154011.4EA272B8E765BF38@mrodeny.com.sa> R . Subject: =?UTF-8?B?WW91ciBNZXRhTWFzayB3YWxsZXQgd2lsbCBiZSBzdXNwZW5kZWQu?= 4 4 Content-Transfer-Encoding: quoted-printable 7 2 Content-Type: text/html; charset="iso-8859-1" ) / Date: 11 Feb 2025 15:40:11 +0100 R Return-Path: <info@mrodeny.com.sa> Return-path: <info@mrodeny.com.sa> % - To: info@bcmuslimgolfers.com ( H � � Y � Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 5383 174 NIL NIL NIL NIL �' �g�g x 7 : From: Betty Anderson <betty@websolutionai.com> Y > Message-ID: <CAGG+YMW5k-SWa5ODzjifrYxEgP4Ws8OFZNC_NgBcG3C=gxEe6A@mail.gmail.com> 6 ? Subject: bcmuslimgolfers.com Critical Errors. U A Content-Type: multipart/alternative; boundary="000000000000c82151062dea27d3" . ; Date: Tue, 11 Feb 2025 20:12:53 -0800 Z Return-Path: <betty@websolutionai.com> Return-path: <betty@websolutionai.com> 9 9 Sender: Betty Anderson <betty@websolutionai.com> , @ To: Info <info@bcmuslimgolfers.com> � A w � � H � W Z m � 6 H z V Y � � ? � ("text" "plain" ("charset" "UTF-8") NIL NIL "quoted-printable" 1955 54 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 4832 63 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000c82151062dea27d3") NIL NIL NIL �3 � �g p / ) From: Jeff Haden <jeffhad@outlook.com> k . Message-ID: <TYZPR01MB3871B57FB605FAC64CA1A2DCBEFE2@TYZPR01MB3871.apcprd01.prod.exchangelabs.com> I * Subject: Re: Follow-up | Accounting, Tax & Bookkeeping Services? w g Content-Type: multipart/alternative; boundary="_000_TYZPR01MB3871B57FB605FAC64CA1A2DCBEFE2TYZPR01MB3871apcp_" . - Date: Fri, 14 Feb 2025 13:02:13 +0000 R Return-Path: <jeffhad@outlook.com> Return-path: <jeffhad@outlook.com> � A �( �) � t H 0) Z ] � � H �- Y \ � � W ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 1021 31 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 2805 87 NIL NIL NIL NIL) "alternative" ("boundary" "_000_TYZPR01MB3871B57FB605FAC64CA1A2DCBEFE2TYZPR01MB3871apcp_") NIL ("en-US") NIL �8 4?�g � G From: TENDER PROCUMENT (EXT) <info-enocprocure@consultant.com> E Message-ID: <20250214164956.F2986EC28B115BBD@consultant.com> # Subject: Vendor Invitation 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 14 Feb 2025 16:49:56 +0100 @ Reply-To: TENDER PROCUMENT (EXT) <info@enocprocure.com> j Return-Path: <info-enocprocure@consultant.com> Return-path: <info-enocprocure@consultant.com> % To: info@bcmuslimgolfers.com ( H v � x � X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 648 16 NIL NIL NIL NIL � Tf�g ? From: Hot Watches <yutivulplrealistically@oogpunt.net> ; R Subject: ***SPAM*** Luxury Watches at Just $250! ( Content-Transfer-Encoding: 8bit 7 Content-Type: text/html; charset="WINDOWS-874" . Date: Fri, 19 Mar 2025 12:21:22 +0000 p Return-Path: <yutivulplrealistically@oogpunt.net> Return-path: <yutivulplrealistically@oogpunt.net> , To: info <info@bcmuslimgolfers.com> ( H J � � 6 P N "text" "html" ("charset" "WINDOWS-874") NIL NIL "8bit" 2614 80 NIL NIL NIL NIL 0 �_�g x 6 : From: Kyle Carter <kcarter@websolutionai.com> Y > Message-ID: <CABAft3x8ruPG+WMjsntLNq7HyXpVxeWpuR_pBK-cAqOHq1ikbQ@mail.gmail.com> A ? Subject: Re : bcmuslimgolfers.com Can I send a Proposal? U A Content-Type: multipart/alternative; boundary="00000000000064edd0062ea0c0c0" . ; Date: Fri, 21 Feb 2025 06:03:36 +0000 ^ Return-Path: <kcarter@websolutionai.com> Return-path: <kcarter@websolutionai.com> 8 9 Sender: Kyle Carter <kcarter@websolutionai.com> , @ To: Info <info@bcmuslimgolfers.com> � A � � � 3 H � + - D & H V Y � @ � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 1348 38 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 4867 64 NIL NIL NIL NIL) "alternative" ("boundary" "00000000000064edd0062ea0c0c0") NIL NIL NIL R1 j�g x K % From: "=?UTF-8?B?TWV0YU1hc2s=?=" <support@coachmastersacademy.com> N ) Message-ID: <20250221125933.F63907559DD21A33@coachmastersacademy.com> F ' Subject: =?UTF-8?B?WW91ciB3YWxsZXQgd2lsbCBiZSBzdXNwZW5kZWQh?= 4 - Content-Transfer-Encoding: quoted-printable 7 + Content-Type: text/html; charset="iso-8859-1" ) ( Date: 21 Feb 2025 12:59:33 +0100 j Return-Path: <support@coachmastersacademy.com> Return-path: <support@coachmastersacademy.com> % & To: info@bcmuslimgolfers.com ( H � - � K � Z "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 4939 149 NIL NIL NIL NIL ~( �j�g � = " From: $250 Luxury Watches <bqufatariff@schoders.net> v Message-ID: <81b7fd6f998598e583c007d4b.549ba6201a.20241224201505.8d0cb09e02.7a341244@mail170.atl21.rsgsv.net> � Z Subject: ***SPAM*** =?windows-1256?B?RGlzY292ZXIgT3VyIEV4Y2x1c2k=?= =?windows-1256?B?dmUgTHV4dXJ5IFdhdGNoZXMgliA=?= =?windows-1256?B?T25seSAkMjUwIQ==?= ( ' Content-Transfer-Encoding: 8bit 9 % Content-Type: text/html; charset="windows-1256" . Date: Tue, 24 Dec 2024 20:15:17 +0000 \ Return-Path: <bqufatariff@schoders.net> Return-path: <bqufatariff@schoders.net> , # To: info <info@bcmuslimgolfers.com> ( H f � � G O "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 2504 71 NIL NIL NIL NIL � ѳ�g � m From: " =?UTF-8?B?QmNtdXNsaW1nb2xmZXJzIE1haWxzZXJ2ZXIg4oSiwq4g?=" <lcps02.mail28-noreply@gwpp1.net> @ Message-ID: <20250224021205.DDD04F4DF4BE30F3@gwpp1.net> � X Subject: ***SPAM*** [CASE ID: #LMB-ibjkcwrkff: Update Service Terms and Condtions on bcmuslimgolfers.com To Avoid info@bcmuslimgolfers.com being terminated 4 ! Content-Transfer-Encoding: quoted-printable Content-Type: text/html ) Date: 24 Feb 2025 02:12:05 +0100 j Return-Path: <lcps02.mail28-noreply@gwpp1.net> Return-path: <lcps02.mail28-noreply@gwpp1.net> % To: info@bcmuslimgolfers.com ( H � $ � v X "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 4624 118 NIL NIL NIL NIL e% һg � 9 " From: "DigitalME" <tvpzchh@sumitomoplastics.com> N ' Message-Id: <20250218235340.11FE2193B0EE5C@mail.sumitomoplastics.com> ? P Subject: ***SPAM*** Marketing Tools FOR FREE L.e.a.d ! $ Content-Type: text/plain . & Date: Tue, 18 Feb 2025 20:53:41 -0300 0 % Reply-To: respostainteressado@gmail.com d Return-Path: <tvpzchh@sumitomoplastics.com> Return-path: <tvpzchh@sumitomoplastics.com> # To: info@gqmasken.com 0 ( H ? � � � � ���g � 7 ' From: "Mr. BNY Mellon" <bnymellon11@gmail.com> B * Message-Id: <20250224085522.2949E8A709F7@mx.itans.com.br> D h Subject: ***SPAM*** Re : Business Partnership Inquiry ... 4 $ Content-Transfer-Encoding: quoted-printable 7 " Content-Type: text/plain; charset="iso-8859-1" . ( Date: Mon, 24 Feb 2025 01:36:17 -0800 ( ) Reply-To: bnymellon11@gmail.com V Return-Path: <bnymellon11@gmail.com> Return-path: <bnymellon11@gmail.com> / & To: Recipients <bnymellon11@gmail.com> ( H l � � i "text" "plain" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 982 31 NIL NIL NIL NIL � �ڽg , 2 From: "SUPER LIST" <etipin@ruanzheng.com> P ? Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Sun, 23 Feb 2025 17:37:53 +0800 T Return-Path: <etipin@ruanzheng.com> Return-path: <etipin@ruanzheng.com> To: contact@nexio.com 0 ( Z � � $ F I�g � : From: Luxury Watches <cegrbumpy@voicecasting.net> { Message-ID: <CCRM5JO5JQ-DHUQOOHDQ0-D4TDFWRKAC-80XCC4GQ6P7UEGO800TE27JKHYE8CT7QIP0MBBHHBNKGKCUCND@voicecasting.net> P [ Subject: ***SPAM*** Luxury Watches Collection for You. $250 per Watch 4 % Content-Transfer-Encoding: Quoted-Printable 9 # Content-Type: text/html; charset="windows-1250" . Date: Mon, 23 Dec 2024 13:00:49 +0000 ` Return-Path: <cegrbumpy@voicecasting.net> Return-path: <cegrbumpy@voicecasting.net> , ! To: info <info@bcmuslimgolfers.com> ( H & � ` � m \ "text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 3277 109 NIL NIL NIL NIL � �q�g � ? From: "SUPER LIST" <rxdwbw@puertocoatzacoalcos.com.mx> Y Message-Id: <202503010309.52139HUR000773-52139HUT000773@fortimail.apicoatza.com> P E Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Sat, 1 Mar 2025 11:09:19 +0800 n Return-Path: <rxdwbw@puertocoatzacoalcos.com.mx> Return-path: <rxdwbw@puertocoatzacoalcos.com.mx> " To: saatvik.s12@gmail.com 0 ( � � $ � �z�g � ; From: Saumya Contact <contacts@global2-pharma.pro> I Message-ID: <20250301223959.BF8508A19B4C8877@global2-pharma.pro> H W Subject: ***SPAM*** Re: Business Collaboration Opportunity!! 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 01 Mar 2025 22:40:00 -0800 ; Reply-To: Saumya Contact <contact@saumya-mail.com> b Return-Path: <contacts@global2-pharma.pro> Return-path: <contacts@global2-pharma.pro> % To: info@bcmuslimgolfers.com ( H � / � � X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 665 11 NIL NIL NIL NIL e o��g � E From: $250 Luxury Watches <mcscreenplay@haflinger-tirol.net> q Message-ID: <haflinger-tirol.net.63O6SKJG3L.PEETAH6M12PQ2OUN0FFP-VWOQ1O5PMN20.MNJDI@haflinger-tirol.net> ? R Subject: ***SPAM*** Exclusive Luxury Watches at $250 ( Content-Transfer-Encoding: 8bit 2 Content-Type: text/html; charset="utf-8" . Date: Wed, 25 Dec 2025 01:29:38 +0000 l Return-Path: <mcscreenplay@haflinger-tirol.net> Return-path: <mcscreenplay@haflinger-tirol.net> , To: info <info@bcmuslimgolfers.com> ! X-Priority: 3 ( H Y � c I H "text" "html" ("charset" "utf-8") NIL NIL "8bit" 2403 73 NIL NIL NIL NIL s ���g 0 + From: "DHL EXPRESS" <dhl1@dhl.com> E Message-Id: <E1tq0rk-0008F5-W6@server.supershuttleferry.com> , Subject: Original Shipment Document N Content-Type: multipart/mixed; boundary="===============2088634056==" . Date: Thu, 06 Mar 2025 02:49:59 +0100 D Return-Path: <dhl1@dhl.com> Return-path: <dhl1@dhl.com> & To: Recipients <dhl1@dhl.com> � A 1 o [v �� A � _ b , �, H � � � = M H � � � @' �' � @ 9 � � �H Fx � (("text" "plain" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 845 16 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL "Mail message body" "quoted-printable" 10184 136 NIL NIL NIL NIL) "alternative" ("boundary" "===============0198816774==") NIL NIL NIL)("application" "octet-stream" NIL NIL NIL "base64" 948294 NIL ("attachment" ("filename" "DHL_AWB#6078538091.rar")) NIL NIL) "mixed" ("boundary" "===============2088634056==") NIL NIL NIL �� ���g � O From: "The Magic Seven sender" <rscqytsisr@puertocoatzacoalcos.com.mx> Y Message-Id: <202503062206.526M6kRv025427-526M6kRx025427@fortimail.apicoatza.com> G A Subject: ***SPAM*** Send UNLIMITED emails with 100% delivery - Date: Fri, 7 Mar 2025 05:06:49 +0700 v Return-Path: <rscqytsisr@puertocoatzacoalcos.com.mx> Return-path: <rscqytsisr@puertocoatzacoalcos.com.mx> # To: robslawinski@yahoo.com 0 ( � K p % � �g � D From: "The Magic Seven sender" <qktsgokamis@isdisadown.com> N Message-Id: <E1tqJNL-00EnDv-Sy@usc5-srv1.relay.ahi.mail.usgovdod.com> G > Subject: ***SPAM*** Send UNLIMITED emails with 100% delivery - Date: Fri, 7 Mar 2025 05:07:31 +0700 ` Return-Path: <qktsgokamis@isdisadown.com> Return-path: <qktsgokamis@isdisadown.com> & To: mkg@teamcargoshipping.com 0 ( � � K p % � � �g � R From: Luxury Bags at an Unbelievable Price! <registerxrijqthj@bosese.com> � Message-ID: <ewtyax.VZKKTEPLHRJENVOXZCAAENYIJORFINUYSNSNWHLDQMUCKKNBVCDDCDNGSBZZLPCJKRCWIPXXUZNKXDCKNMJPCKOIOOSNQPJOGNQQ.aniddo.vhrhlz@bosese.com> D I Subject: ***SPAM*** Luxury Bags at an Unbelievable Price! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1250" - Date: Fri, 7 Mar 2025 09:50:41 +0630 b Return-Path: <registerxrijqthj@bosese.com> Return-path: <registerxrijqthj@bosese.com> , To: info <info@bcmuslimgolfers.com> ( H � z � O "text" "html" ("charset" "windows-1250") NIL NIL "8bit" 1683 25 NIL NIL NIL NIL 1 Cf�g � S From: Exclusive Luxury Watches - Only $250 <zggjhptbdbravely@hh.szmoa.com> p Message-ID: <mrqzgvtljdfbiagopvdui.qpqfgsmvunfnafdafahyyswilwvcue.jnyyn.pubfv.mvvcr.eolyg@hh.szmoa.com> x L Subject: ***SPAM*** Get your hands on premium luxury watches at an unbeatable price. Limited stock available! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" - Date: Sat, 8 Mar 2025 17:41:43 +0630 f Return-Path: <zggjhptbdbravely@hh.szmoa.com> Return-path: <zggjhptbdbravely@hh.szmoa.com> , To: info <info@bcmuslimgolfers.com> ( H � � � � O "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 1731 29 NIL NIL NIL NIL I +&�g � 9 From: Luxury watches <ixgcfskx@epuniversity.net> m Message-ID: <list-jrparis.netZRGEDMTGZU0.64ZXQ3UAGJLW4UGXZZCQ-AJSY5G0UCXLV.I6QR2@a.epuniversity.net> D ] Subject: ***SPAM*** Luxury Watches Starting at Just $250! 4 $ Content-Transfer-Encoding: Quoted-Printable 7 # Content-Type: text/html; charset="WINDOWS-874" . ! Date: Wed, 12 Mar 2025 18:11:37 +0530 ^ Return-Path: <ixgcfskx@epuniversity.net> Return-path: <ixgcfskx@epuniversity.net> , To: info <info@bcmuslimgolfers.com> ( H � � � � R Z "text" "html" ("charset" "WINDOWS-874") NIL NIL "Quoted-Printable" 2519 82 NIL NIL NIL NIL $ <��g � 9 ) From: Aisha Ahuja <aisha.seoservice@outlook.com> f / Message-ID: <DM4PR12MB615874DDCFF9826E5C5CDFBA84D02@DM4PR12MB6158.namprd12.prod.outlook.com> + Subject: quik w k Content-Type: multipart/alternative; boundary="_000_DM4PR12MB615874DDCFF9826E5C5CDFBA84D02DM4PR12MB6158namp_" . . Date: Wed, 12 Mar 2025 21:30:00 +0000 d Return-Path: <aisha.seoservice@outlook.com> Return-path: <aisha.seoservice@outlook.com> J * To: "rahulpal8006169301@gmail.com" <rahulpal8006169301@gmail.com> � A :( �( � � H z( \ _ � � H �* [ ^ � � O # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 421 17 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 3539 79 NIL NIL NIL NIL) "alternative" ("boundary" "_000_DM4PR12MB615874DDCFF9826E5C5CDFBA84D02DM4PR12MB6158namp_") NIL ("en-US") NIL �8 ��g � F From: Luxury Watches Await You! <porticonhc@newsxpress24.net> z Message-ID: <CRMTOYWJ7YBL5.PAMTJKNUED85ZH8G8NUMBJP-AH2X0ZSIKZNCG6PXXMQJ3M.RJIYZ2RH2MMHBYLUYO8QF@newsxpress24.net> D ] Subject: ***SPAM*** Luxury Watches Await You - Only $250! 4 Content-Transfer-Encoding: Quoted-Printable 1 Content-Type: text/html; charset="UTF-8" . Date: Fri, 21 Feb 2025 12:21:22 +0000 b Return-Path: <porticonhc@newsxpress24.net> Return-path: <porticonhc@newsxpress24.net> , To: info <info@bcmuslimgolfers.com> ( H � � � N T "text" "html" ("charset" "UTF-8") NIL NIL "Quoted-Printable" 2591 78 NIL NIL NIL NIL n �D�g � { From: " =?UTF-8?B?QmNtdXNsaW1nb2xmZXJzIE1haWxzZXJ2ZXIg4oSiwq4g?=" <domainapi-virtualcloudmanager.com@pqsoil.com> A Message-ID: <20250318001851.21387503B8F0500C@pqsoil.com> o e Subject: ***SPAM*** [Case ID: #BGR-jcdslabqnc :Consolidated Renewal Reminder for bcmuslimgolfers.com 4 ! Content-Transfer-Encoding: quoted-printable Content-Type: text/html ) Date: 18 Mar 2025 00:18:51 +0100 � Return-Path: <domainapi-virtualcloudmanager.com@pqsoil.com> Return-path: <domainapi-virtualcloudmanager.com@pqsoil.com> % To: info@bcmuslimgolfers.com ( H p �& g' � Y "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 10087 144 NIL NIL NIL NIL �= 44�g � K From: Luxury Watches for Only $250! <hotsales@oneladyguzellik.com> ` Message-ID: <177976867.742133316.093526613286911238805692773866148@oneladyguzellik.com> U ? Subject: ***SPAM*** Luxury Watches on Sale for a Limited Time - Only $250! � Content-Type: multipart/alternative; boundary="=__--==--5pvqvlu9pey8fysmcdw0layhdjhjknlmdsjkedijybebga6keneqnodsutweupr57wdoapub3p4gkrcjqpjtuupuykd3ddxi6lbciqho8xvmjiu4pr4cy1gxspyqp0b--==--__=" . Date: Fri, 21 Mar 2025 13:00:06 +0530 d Return-Path: <hotsales@oneladyguzellik.com> Return-path: <hotsales@oneladyguzellik.com> , To: info <info@bcmuslimgolfers.com> � A � � @ H � \ ` * 7 H � [ _ S C H � � ("text" "plain" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 311 13 NIL NIL NIL NIL)("text" "html" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 2899 67 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "=__--==--5pvqvlu9pey8fysmcdw0layhdjhjknlmdsjkedijybebga6keneqnodsutweupr57wdoapub3p4gkrcjqpjtuupuykd3ddxi6lbciqho8xvmjiu4pr4cy1gxspyqp0b--==--__=") NIL NIL NIL � ��g � 3 From: "LLP KUNZHAN" <apicoa@apicoatza.com> Y Message-Id: <202503240031.52O0VSSP006389-52O0VSSX006389@fortimail.apicoatza.com> F G Subject: ***SPAM*** Products Offer (CIF, TTO and FOB - SCO) 4 Content-Transfer-Encoding: quoted-printable 2 Content-Type: text/plain; charset="utf-8" . Date: Mon, 24 Mar 2025 00:31:51 +0000 " Reply-To: info@kunzhan.kz T Return-Path: <apicoa@apicoatza.com> Return-path: <apicoa@apicoatza.com> . To: Recipients <apicoa@apicoatza.com> ( H � d "text" "plain" ("charset" "utf-8") NIL "Mail message body" "quoted-printable" 790 21 NIL NIL NIL NIL � 6��g � + From: Watches <sales@dans50th.com> q Message-ID: <ku6gucccr8qndte.8sgbpdnbnq2p3ovevbhlthgzp.p6gj8uozu37bxzshpmphiv8uo1yhwp0tbpj@dans50th.com> P < Subject: ***SPAM*** Top Luxury Watches Starting at $250 - Shop Today! s Content-Type: multipart/alternative; boundary="====__01015717fntpttxkkrcu076bf9gxtgp1zdhsrgolezwtn__====" . Date: Tue, 25 Mar 2025 09:00:19 +0530 P Return-Path: <sales@dans50th.com> Return-path: <sales@dans50th.com> , To: info <info@bcmuslimgolfers.com> � A � � � H _ c � � H 6 ^ b � � F ("text" "plain" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 921 16 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 2246 70 NIL NIL NIL NIL) "alternative" ("boundary" "====__01015717fntpttxkkrcu076bf9gxtgp1zdhsrgolezwtn__====") NIL NIL NIL T ~#�g T 2 From: "Admin Update " <info@snedgird.cc> B Message-ID: <20250327004341.A9C5E73B226D0207@snedgird.cc> � e Subject: ***SPAM*** [Report ID: #SAC-wbnxxwtifrar: Employee's Urgent reconfirmation needed for info@bcmuslimgolfers.com 4 ! Content-Transfer-Encoding: quoted-printable Content-Type: text/html ) Date: 27 Mar 2025 00:43:41 +0100 L Return-Path: <info@snedgird.cc> Return-path: <info@snedgird.cc> % To: info@bcmuslimgolfers.com ( H u � @ � G W "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 4743 71 NIL NIL NIL NIL �( _��g � < From: Exclusive Luxury Bags <noreply@fzdongbai.com> � Message-ID: <zgoxmcuwzivz0glragkk3wm6g.zjjiosy8gue3yuncsslinzoudwtzcxit4ifswyaggvnpx-gugy3.qknc56utgucvkew1w1743076406@fzdongbai.com> ` = Subject: ***SPAM*** Discover a collection of exquisite luxury bags, all at just $200! � Content-Type: multipart/alternative; boundary="_____acxnc7khqn9zkdaspro6siiamuug1itb657ymay6vbxqd9evnwylglga4fp1oiixwbtihvrfuuqft28kj3okzrx6mjs5fpm3geryy______" . Date: Thu, 27 Mar 2025 18:23:12 +0630 V Return-Path: <noreply@fzdongbai.com> Return-path: <noreply@fzdongbai.com> , To: info <info@bcmuslimgolfers.com> � A v � � 8 H _ c � � H � ^ b = + H k � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 162 7 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 1853 43 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "_____acxnc7khqn9zkdaspro6siiamuug1itb657ymay6vbxqd9evnwylglga4fp1oiixwbtihvrfuuqft28kj3okzrx6mjs5fpm3geryy______") NIL NIL NIL l l<�g � W From: "Admin Update " <mail101-wc21systupgrade.notify@clientconfigportal.com> M Message-ID: <20250328021238.5F92FE1D5F6C3F2E@clientconfigportal.com> � d Subject: ***SPAM*** [Case ID: #FGB-kfxotlkccvomhe: Employee's Urgent reconfirmation needed for info@bcmuslimgolfers.com 4 " Content-Transfer-Encoding: quoted-printable ! Content-Type: text/html ) Date: 28 Mar 2025 02:12:38 +0100 � Return-Path: <mail101-wc21systupgrade.notify@clientconfigportal.com> Return-path: <mail101-wc21systupgrade.notify@clientconfigportal.com> % To: info@bcmuslimgolfers.com ( H � * ` � H W "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 4776 72 NIL NIL NIL NIL %) Oo�g � = From: Gonzalez Contact <contacts@consult-inter.info> I Message-ID: <20250328105851.B3657DF6A1A46B70@consult-inter.info> E \ Subject: ***SPAM*** Re: Investment and Project Financing!! 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 28 Mar 2025 10:58:51 -0700 > Reply-To: Gonzalez Contact <contact@gonzale-mail.com> b Return-Path: <contacts@consult-inter.info> Return-path: <contacts@consult-inter.info> % To: info@bcmuslimgolfers.com ( H � J X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 538 10 NIL NIL NIL NIL � ���g 2 From: "BOOM OF SALES" <zlecb@intercom.pw> A = Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Fri, 28 Mar 2025 09:32:23 +0700 N Return-Path: <zlecb@intercom.pw> Return-path: <zlecb@intercom.pw> To: info@seatexx.com 0 ( . l � > � a��g � : From: Luxury Watches Big Save <online@amaaze.net> � Message-ID: <tcasidmowutvdbmocnccqxjqhmesppclve.vohlxqeayujlhmnnotivomsffoysnnjqqpifowoxhcl.ycoajfisvxjm.twyzcyyhlis@amaaze.net> � B Subject: ***SPAM*** Upgrade your style with our exquisite collection of luxury watches. Premium quality at an unbeatable price! � Content-Type: multipart/alternative; boundary="----df1fjhfs1tu840xknhptuyqggfdwwzpj6yjuhbig60lezmkgwvco3qdohasksnrkgqdjn2ilp7lme2i39hmgcssqhripcghx7dq----" . Date: Sun, 30 Mar 2025 02:20:29 +0530 N Return-Path: <online@amaaze.net> Return-path: <online@amaaze.net> , To: info <info@bcmuslimgolfers.com> � A z � � � H X \ H � W [ g � % H � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 10 2 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1676 37 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "----df1fjhfs1tu840xknhptuyqggfdwwzpj6yjuhbig60lezmkgwvco3qdohasksnrkgqdjn2ilp7lme2i39hmgcssqhripcghx7dq----") NIL NIL NIL F]�g 4 - From: McCarthy GREEN<info@arblu.com> @ Message-ID: <20250331102010.C22486AF6F7A1397@arblu.com> / E Subject: ***SPAM*** BUSINESS REQUEST 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 31 Mar 2025 10:20:10 -0700 + Reply-To: mccarthygreen9@gmail.com H Return-Path: <info@arblu.com> Return-path: <info@arblu.com> % To: info@bcmuslimgolfers.com ( H : � � $ 5 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 2340 53 NIL NIL NIL NIL ) ���g � ; From: Luxury Watches Only $250! <sales@weiniu.net> q Message-ID: <oxvcuqseyik0h0rpeu5ykxyyontqypnj29cewa0ako.766403908273-17135543025.53876131633@weiniu.net> L B Subject: ***SPAM*** Luxury Watches Limited Time Sale - Only $250! � Content-Type: multipart/alternative; boundary="=__--==--wjgfib7y8qlxql4yr8kbjtypxqgqi0m33ser4ic1or6r7aziliqjusjie504vma0hndcyrdak7zvcejea79unzdgsziondpxo8gmdrway94u6af001mrkfriv979ure--==--" - Date: Wed, 2 Apr 2025 06:11:59 +0530 L Return-Path: <sales@weiniu.net> Return-path: <sales@weiniu.net> , To: info <info@bcmuslimgolfers.com> � A L � � H \ ` � � H � [ _ | � : H � ("text" "plain" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 178 7 NIL NIL NIL NIL)("text" "html" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 2486 58 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "=__--==--wjgfib7y8qlxql4yr8kbjtypxqgqi0m33ser4ic1or6r7aziliqjusjie504vma0hndcyrdak7zvcejea79unzdgsziondpxo8gmdrway94u6af001mrkfriv979ure--==--") NIL NIL NIL ��g X 7 ) From: Avichai Malik <AvichaiMalik@hotmail.com> e . Message-ID: <SY7P282MB44390533B2FB2D3425A7E8BBD0AE2@SY7P282MB4439.AUSP282.PROD.OUTLOOK.COM> * Subject: Proposal w l Content-Type: multipart/alternative; boundary="_000_SY7P282MB44390533B2FB2D3425A7E8BBD0AE2SY7P282MB4439AUSP_" - - Date: Thu, 3 Apr 2025 11:01:26 +0000 \ Return-Path: <AvichaiMalik@hotmail.com> Return-path: <AvichaiMalik@hotmail.com> � A 6* �* D( ) H v* ^ a � � ) H �0 ] ` ! �! � ) ("text" "plain" ("charset" "Windows-1252") NIL NIL "quoted-printable" 1513 41 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "quoted-printable" 8618 165 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SY7P282MB44390533B2FB2D3425A7E8BBD0AE2SY7P282MB4439AUSP_") NIL ("en-GB") NIL zR k�g D From: Discount Luxury Watches <watches@lestaxisanglais.net> � Message-ID: <pybbcl1bc9ntaomfmul.6jgzq86tdgtomsfbdoywfnqrmnjbhlaxtgo1uicztl8v4scldeegzzmyfga7bhuqpmifsfhgbjtxoohqzhpifxxxmuyf5xmvjuc9rbc8rypuum75fk.wkisoksafaqgp.k78hoa8jzkp2a4s@lestaxisanglais.net> H Subject: Timeless Elegance, Unmatched Price - Starting at $250! r Content-Type: multipart/alternative; boundary="=_myowscaalu0uy5bim77dt6xq6nyhgeqoqufjtetip9rqkavise_=--" - Date: Sun, 6 Apr 2025 18:00:39 +0530 b Return-Path: <watches@lestaxisanglais.net> Return-path: <watches@lestaxisanglais.net> , To: info <info@bcmuslimgolfers.com> � A � � � 1 H � ^ b H � ] a > x : ("text" "plain" ("charset" "windows-874") NIL NIL "Quoted-Printable" 10 2 NIL NIL NIL NIL)("text" "html" ("charset" "windows-874") NIL NIL "Quoted-Printable" 2424 58 NIL NIL NIL NIL) "alternative" ("boundary" "=_myowscaalu0uy5bim77dt6xq6nyhgeqoqufjtetip9rqkavise_=--") NIL NIL NIL l %t�g � t From: =?windows-1250?B?THV4dXJ5IEJhZ3MgliBUaW1lbGU=?= =?windows-1250?B?c3MgRWxlZ2FuY2Uh?= <sara@cgwmb.com> � Message-ID: <GWAGWWFHBUXUKYEWFLTNLT.ZUJKJODEKIXMNRDMWNDSARSOV-YBIPOHRERYMHELAENKYFTJDRX.OJEVFZDSICZWHWFIYZEPFZFCQ@cgwmb.com> B E Subject: ***SPAM*** Luxury Bags at an Unbeatable Price! � Content-Type: multipart/alternative; boundary="__==___qsoqyrjflzh2ipizug9qgnhkh20oaqxecitreave3rruy0k4yeky633qdvkzofobjsx07ojxegwca7kowdlpfowoj3ajtldfqshkh____" - Date: Mon, 7 Apr 2025 02:07:54 +0630 H Return-Path: <sara@cgwmb.com> Return-path: <sara@cgwmb.com> , To: info <info@bcmuslimgolfers.com> � A � 1 � � H � L P � � H � R V $ H � ~ ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 149 4 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "8bit" 1572 19 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___qsoqyrjflzh2ipizug9qgnhkh20oaqxecitreave3rruy0k4yeky633qdvkzofobjsx07ojxegwca7kowdlpfowoj3ajtldfqshkh____") NIL NIL NIL � R��g < . From: McCarthy GREEN<info@bosqar.com> A Message-ID: <20250407203441.E0B126C38AA05561@bosqar.com> / K Subject: ***SPAM*** BUSINESS REQUEST 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 07 Apr 2025 20:34:41 -0700 + Reply-To: mccarthygreen9@gmail.com J Return-Path: <info@bosqar.com> Return-path: <info@bosqar.com> % To: info@bcmuslimgolfers.com ( H ! m � " 4 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 2338 52 NIL NIL NIL NIL ���g D , From: Ali Sheriff <info@augyva.com> A Message-ID: <20250412124806.3D520688B22F6DF2@augyva.com> > B Subject: ***SPAM*** Loan Investment Program Request 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 12 Apr 2025 12:48:06 -0700 * Reply-To: alisheriff421@gmail.com J Return-Path: <info@augyva.com> Return-path: <info@augyva.com> % To: info@bcmuslimgolfers.com ( H A � ^ m T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 365 15 NIL NIL NIL NIL � ��g T 6 ) From: Ashley Hill <ashleyhill025@hotmail.com> e . Message-ID: <SL2P216MB216523429ECB0A2E3F99251AF3B02@SL2P216MB2165.KORP216.PROD.OUTLOOK.COM> * Subject: Re: Cost? w h Content-Type: multipart/alternative; boundary="_000_SL2P216MB216523429ECB0A2E3F99251AF3B02SL2P216MB2165KORP_" . - Date: Sun, 13 Apr 2025 12:32:49 +0000 ^ Return-Path: <ashleyhill025@hotmail.com> Return-path: <ashleyhill025@hotmail.com> � A k) * 4 z H �) \ _ H I+ [ ^ � � 1 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 267 10 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2025 49 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SL2P216MB216523429ECB0A2E3F99251AF3B02SL2P216MB2165KORP_") NIL ("en-US") NIL �3 .��g � 1 From: Top Luxury Bags <autumn@szmoa.com> z Message-ID: <nkqaewfxgwxswhizqmftgrebfloqjwqne.sxqlmaiftkezb-ramlssfznxmla.jinipzdftrunf.amkjjaepbocin@szmoa.com> L E Subject: ***SPAM*** Luxury Bags - Timeless Elegance for Just $200 � Content-Type: multipart/alternative; boundary="__==___dyhg5otin2d5vuh8n3edxdoa81cozxdl3x5xoh7bpej4qpt3czyrdozdufdg3zzwnzcbpdxbnszsjgkwsebdmxgmskyvfnvvzyyt5____==__" . Date: Thu, 17 Apr 2025 04:27:07 +0630 L Return-Path: <autumn@szmoa.com> Return-path: <autumn@szmoa.com> , To: info <info@bcmuslimgolfers.com> � A � � ' { H 9 _ c � � H � ^ b 9 q 8 H � � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 677 12 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 1649 56 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___dyhg5otin2d5vuh8n3edxdoa81cozxdl3x5xoh7bpej4qpt3czyrdozdufdg3zzwnzcbpdxbnszsjgkwsebdmxgmskyvfnvvzyyt5____==__") NIL NIL NIL � �' h | ) From: Hot Watches <joy@ppqp.net> � Message-ID: <0W6FOIJ0MXHW.JGEKSTTKWVNEUG6O1OY0V7UTDJRI9QH3HELFOYNYWCN0QOWHDZTYPBJPPMIUASWUB0ONGK7OVCBLUZET.DN.PJYJG0OA95WD@ppqp.net> L Subject: Elevate Your Style with Luxury Watches - Starting at $250! 4 Content-Transfer-Encoding: Quoted-Printable 8 Content-Type: text/html; charset="WINDOWS-1255" . Date: Fri, 18 Apr 2025 02:29:00 +1000 D Return-Path: <joy@ppqp.net> Return-path: <joy@ppqp.net> , To: info <info@bcmuslimgolfers.com> ( H O � + � m \ "text" "html" ("charset" "WINDOWS-1255") NIL NIL "Quoted-Printable" 3480 109 NIL NIL NIL NIL z },h x ; From: Luxury Watches Big Save <virginia@xdf43.com> � Message-ID: <mbsqwaccbpwnhtthrlozhsrougpffnpmov.oyffndsnoannuvojqygjpqikjvxyrptunsjtrpsvipr.qeafzzezafaw.leltxdqwdeq@xdf43.com> 8 Subject: Discover Timeless Luxury for Just $250 � Content-Type: multipart/alternative; boundary="----zfau0zd1xxekc672ez1rvmruucskxh8vx5knqnapearmizecrklz4sggr4e10vdfvdshjzinxdizz9dlak2cjufi3ss0nrt8ax7----" . Date: Sun, 20 Apr 2025 04:04:28 +1000 P Return-Path: <virginia@xdf43.com> Return-path: <virginia@xdf43.com> , To: info <info@bcmuslimgolfers.com> � A � � J H s X \ \ j H � W [ _ � E H � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 874 14 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1956 69 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "----zfau0zd1xxekc672ez1rvmruucskxh8vx5knqnapearmizecrklz4sggr4e10vdfvdshjzinxdizz9dlak2cjufi3ss0nrt8ax7----") NIL NIL NIL � ��h 4 , From: Ali Sheriff <info@dammid.com> A Message-ID: <20250419131656.E7A6D42BC7325893@dammid.com> . G Subject: ***SPAM*** LOAN/INVESTMENT 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 19 Apr 2025 13:16:56 -0700 * Reply-To: alisheriff421@gmail.com J Return-Path: <info@dammid.com> Return-path: <info@dammid.com> % To: info@bcmuslimgolfers.com ( H } � ^ m T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 365 15 NIL NIL NIL NIL � �h � 1 From: Louis Vuitton <victoria@cye34.com> J Message-ID: <JTDKDZJGUYAIQDLLEYO.W.ZXGZNQKIDJVRNEOCPPL@cye34.com> � F Subject: ***SPAM*** =?windows-1256?B?SWNvbmljIExvdWlzIFZ1aXR0b24=?= =?windows-1256?B?IEJhZ3MgliBOb3cgZnJvbSBKdXM=?= =?windows-1256?B?dCAkMTY5IQ==?= � Content-Type: multipart/alternative; boundary="___hi02ngxcpxrnxpmlnmxndd3q99zz8q7p6qwy2vhliyhixm13feooosg6icehr5shxlhhekfqjhmpdr1xfdxoijrorcfrk44vfxf76__" . Date: Tue, 22 Apr 2025 03:18:10 +0630 P Return-Path: <victoria@cye34.com> Return-path: <victoria@cye34.com> , To: info <info@bcmuslimgolfers.com> � A t � � � H _ c H � ^ b = q 4 H � � ("text" "plain" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 16 2 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 2417 52 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "___hi02ngxcpxrnxpmlnmxndd3q99zz8q7p6qwy2vhliyhixm13feooosg6icehr5shxlhhekfqjhmpdr1xfdxoijrorcfrk44vfxf76__") NIL NIL NIL � g�h � < From: Saumya Contact <contacts@greaturecomp.it.com> J Message-ID: <20250423013035.507E7388D2CA8DAA@greaturecomp.it.com> H Y Subject: ***SPAM*** Re: Business Collaboration Opportunity!! 4 ! Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 23 Apr 2025 01:30:35 -0700 ; Reply-To: Saumya Contact <contact@saumya-mail.com> d Return-Path: <contacts@greaturecomp.it.com> Return-path: <contacts@greaturecomp.it.com> % To: info@bcmuslimgolfers.com ( H � � z � X "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 906 16 NIL NIL NIL NIL X�h , 3 $ From: "BOOM OF SALES" <lwuzt@e-dpi.com.tw> A Q Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - & Date: Sat, 5 Apr 2025 05:06:32 +0700 P Return-Path: <lwuzt@e-dpi.com.tw> Return-path: <lwuzt@e-dpi.com.tw> / % To: xulylunnghiengcaogiaphat@gmail.com 0 ( j � � > 1 � h � 5 From: Top Luxury Watches <jessica@euk69.com> � Message-ID: <hhzrlcfdtdzgu6xp3mrlt3acn9khpojfco5t.jumsodzzwti8lxcwbm67hlwcp0ppvtpbn.3mrwqrsgzluf.wo8pnki52d9wcpsehp.uk0pubi7mwwv@euk69.com> E D Subject: ***SPAM*** Discover Luxury Watches for Only $250! 4 Content-Transfer-Encoding: Quoted-Printable 3 Content-Type: text/html; charset="euc-kr" . Date: Fri, 25 Apr 2025 20:27:13 +1000 N Return-Path: <jessica@euk69.com> Return-path: <jessica@euk69.com> , To: info <info@bcmuslimgolfers.com> ( H ' l # \ 9 U "text" "html" ("charset" "euc-kr") NIL NIL "Quoted-Printable" 2396 57 NIL NIL NIL NIL J �c h : From: Top Louis Vuitton Bags <lamondra@vlth3.com> p Message-ID: <kuqnwytzmnjaxzdmgvkrldeemyxjtihyr.qhhzuztaukccx-sojnbifpuyjzk.yhg.lcmnoevehvguh@vlth3.com> � A Subject: ***SPAM*** =?windows-1250?B?U3RlcCBJbnRvIFN0eWxlIJYgTG8=?= =?windows-1250?B?dWlzIFZ1aXR0b24gQmFncyBmcm8=?= =?windows-1250?B?bSAkMTY5?= � Content-Type: multipart/alternative; boundary="__==___8t0vixqctiofewvjddko7cs6v9yyrajnlj7hv6ah9h4pqhpxxladappxy9wdrswfgwas3oeqr7zggwupv4scyee1av8zpzn8ah9loonr8crwuck0bpknvvurly____==__" . Date: Mon, 28 Apr 2025 21:34:22 +0630 P Return-Path: <lamondra@vlth3.com> Return-path: <lamondra@vlth3.com> , To: info <info@bcmuslimgolfers.com> � A � X � H � _ c J V H � ^ b z � 5 H - � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 342 12 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 2479 53 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___8t0vixqctiofewvjddko7cs6v9yyrajnlj7hv6ah9h4pqhpxxladappxy9wdrswfgwas3oeqr7zggwupv4scyee1av8zpzn8ah9loonr8crwuck0bpknvvurly____==__") NIL NIL NIL . 5�h p , From: Hot Watches <katie@kvff3.com> { Message-ID: <YJ2IO9ZE8AQO.UILCHNCS6HNV1VBE8DSVMXBFMXXDEFUWGI41AVVDK4C8UEIT0R.GP8YO9XK8OOWO.IMZICFXVHK04@kvff3.com> L Subject: Elevate Your Style with Luxury Watches - Starting at $250! 4 Content-Transfer-Encoding: Quoted-Printable 8 Content-Type: text/html; charset="WINDOWS-1255" . Date: Wed, 30 Apr 2025 00:16:14 +1000 J Return-Path: <katie@kvff3.com> Return-path: <katie@kvff3.com> , To: info <info@bcmuslimgolfers.com> ( H U � + � m \ "text" "html" ("charset" "WINDOWS-1255") NIL NIL "Quoted-Printable" 3480 109 NIL NIL NIL NIL � _�h � : From: Luxury Watches - Only $250 <nacy@ift00.com> � Message-ID: <pilsfonrceedotifkyxtwfsddspbmpnvasa.ccivvvptwunqwoxezlkigvweyzwhrefriqtxurbtlonal.tjjhcnbiolquqdh@ift00.com> 6 Subject: Luxury Watches at Unbeatable Prices! � Content-Type: multipart/alternative; boundary="__==vlgifdxw44q0cpvfu83ng7z03utzdb6ktna6wd8j8xkdex710nw9wftycas1sa0fu8fhjw8xfkzxykcm8omvjwq2tsnnjsit4medhzzaxtmet3pxxn5tfrmbkkx10vdqdbh5sb4==__" - Date: Fri, 2 May 2025 19:51:48 +1000 H Return-Path: <nacy@ift00.com> Return-path: <nacy@ift00.com> , To: info <info@bcmuslimgolfers.com> � A 3 t � � H � X \ ! H � W [ d G H � � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 289 9 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 3172 71 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==vlgifdxw44q0cpvfu83ng7z03utzdb6ktna6wd8j8xkdex710nw9wftycas1sa0fu8fhjw8xfkzxykcm8omvjwq2tsnnjsit4medhzzaxtmet3pxxn5tfrmbkkx10vdqdbh5sb4==__") NIL NIL NIL � �h ` - From: Louis Vuitton <cody@whoz0.com> � Message-ID: <sbxe1wbqq5ak33elrguasy8oxzlbvjbwxonc75yibpdfy7geil.idurreijd99vqabrgwj0bvogj@60fdyj38iic-wkv8v0g.whoz0.com> H F Subject: ***SPAM*** Limited-Time Louis Vuitton Sale from $169 � Content-Type: multipart/alternative; boundary="__==___zha9idcsiz8qkibeckonxyr0sa5dfrs8efi86vdcifrbqpdslaukiuiipxliorsickiujujzgx2fxeyjd5jr____==__" - Date: Fri, 2 May 2025 21:46:53 +0630 H Return-Path: <cody@whoz0.com> Return-path: <cody@whoz0.com> , To: info <info@bcmuslimgolfers.com> � A 4 { 6 � H � X \ � � H Y W [ P � 2 H i � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 218 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 2434 50 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___zha9idcsiz8qkibeckonxyr0sa5dfrs8efi86vdcifrbqpdslaukiuiipxliorsickiujujzgx2fxeyjd5jr____==__") NIL NIL NIL j �h ` 6 ) From: Ashley Hill <ashleyhill017@hotmail.com> f - Message-ID: <SEYPR06MB682908871F30A93ACB4D0231F28F2@SEYPR06MB6829.apcprd06.prod.outlook.com> ( � Subject: ***SPAM*** Re: Cost? w h Content-Type: multipart/alternative; boundary="_000_SEYPR06MB682908871F30A93ACB4D0231F28F2SEYPR06MB6829apcp_" - , Date: Sun, 4 May 2025 13:53:15 +0000 ^ Return-Path: <ashleyhill017@hotmail.com> Return-path: <ashleyhill017@hotmail.com> � A �+ f, j � H �+ \ _ H �- [ ^ � 5 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 286 12 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2322 53 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SEYPR06MB682908871F30A93ACB4D0231F28F2SEYPR06MB6829apcp_") NIL ("en-US") NIL '7 �qh � & From: Omega <katie@ifq76.com> L Message-ID: <0w2tsv5slhknjnyrypkcg8.bc0agiwa0gslfipk4n3r@ifq76.com> M H Subject: ***SPAM*** Omega Seamaster Starting at $250 - Shop Today! � Content-Type: multipart/alternative; boundary="==____=-qu5gkfhue6bcfmjf5gmgllziyfffpir5hyv2sctb1fudgtxzl3qjkcpk2adfouhyslrq70-" - Date: Mon, 5 May 2025 02:06:10 +1000 J Return-Path: <katie@ifq76.com> Return-path: <katie@ifq76.com> , To: info <info@bcmuslimgolfers.com> � A { � K � H � _ c � � H ? ^ b � � , 2 ("text" "plain" ("charset" "windows-1255") NIL NIL "Quoted-Printable" 152 6 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1255") NIL NIL "Quoted-Printable" 2047 44 NIL NIL NIL NIL) "alternative" ("boundary" "==____=-qu5gkfhue6bcfmjf5gmgllziyfffpir5hyv2sctb1fudgtxzl3qjkcpk2adfouhyslrq70-") NIL NIL NIL � ��h : From: Top Louis Vuitton Bags <lamondra@vlth3.com> p Message-ID: <yoyvlibgpnvmgbjbxlfxruxdruiuukkid.utiuzflggguua-zlhdtvggfxhlg.bwh.moodubzgbapif@vlth3.com> � A Subject: ***SPAM*** =?windows-1250?B?U3RlcCBJbnRvIFN0eWxlIJYgTG8=?= =?windows-1250?B?dWlzIFZ1aXR0b24gQmFncyBmcm8=?= =?windows-1250?B?bSAkMTY5?= � Content-Type: multipart/alternative; boundary="__==___4x7xueylj2sbajo5fgfp5kweg5arphzsqmeg3kmzlhj9gg1r6exysoqyyitkluii0q14fyktf6fvfoqyeie2ewd7oqtw3kfferntvlmng3nqqgqrphx4smd3ng____==__" - Date: Tue, 6 May 2025 15:55:43 +0630 P Return-Path: <lamondra@vlth3.com> Return-path: <lamondra@vlth3.com> , To: info <info@bcmuslimgolfers.com> � A � X � H � _ c J V H � ^ b z � 5 H , � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 342 12 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 2479 53 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___4x7xueylj2sbajo5fgfp5kweg5arphzsqmeg3kmzlhj9gg1r6exysoqyyitkluii0q14fyktf6fvfoqyeie2ewd7oqtw3kfferntvlmng3nqqgqrphx4smd3ng____==__") NIL NIL NIL - ��h d @ From: Luxury Watches Huge Discounts <delilah@lcvp0.com> t Message-ID: <PCT8Q5MI7IPEFZ4J9LHWFOUBPAZ9X13W2L5P5CQOV.VMBLZWZAEIZ79YQZ9HDTOA.OEAAWFCUIR6YHA8BMD@lcvp0.com> L E Subject: ***SPAM*** Exclusive Luxury Watches - Special Price $250 � Content-Type: multipart/alternative; boundary="____--=5cfwhhaljoxwxnnyzunyco7uiwnpfanecpn7brulkbdbj5ygeskhg1lv19efuwi1rml8iwtzsozesd=--" - Date: Thu, 8 May 2025 19:38:32 +1000 N Return-Path: <delilah@lcvp0.com> Return-path: <delilah@lcvp0.com> , To: info <info@bcmuslimgolfers.com> � A � ? � B H � _ c � � H � ^ b I � ^ H � � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 394 9 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 3239 94 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "____--=5cfwhhaljoxwxnnyzunyco7uiwnpfanecpn7brulkbdbj5ygeskhg1lv19efuwi1rml8iwtzsozesd=--") NIL NIL NIL � �{ h � 9 From: Top Louis Vuitton Bags <melissa@tzkp1.com> Y Message-ID: <v03dvvf18btss3bh8umppvqdtxf.cumuetbiqtwdlcx-vuxgndu6.t3k@tzkp1.com> � > Subject: ***SPAM*** =?windows-1256?B?RGlzY292ZXIgTHV4dXJ5IGZvciA=?= =?windows-1256?B?TGVzcyCWIExvdWlzIFZ1aXR0b24=?= =?windows-1256?B?IEJhZ3MgZnJvbSBKdXN0ICQxNjk=?= =?windows-1256?B?IQ==?= � Content-Type: multipart/alternative; boundary="__==___mnstqviv3dnmadnu7fmrwn6ectisyhdcsilsdqhouoxkmdqm3mgrgu7pvplexywbyuvt9kr00doqgdo6plaep1zy0eg7woxx2qb9u____" - Date: Thu, 8 May 2025 21:36:19 +0630 N Return-Path: <melissa@tzkp1.com> Return-path: <melissa@tzkp1.com> , To: info <info@bcmuslimgolfers.com> � A � � � � H / _ c � � H � ^ b p � < H / � ("text" "plain" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 247 14 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 2476 60 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___mnstqviv3dnmadnu7fmrwn6ectisyhdcsilsdqhouoxkmdqm3mgrgu7pvplexywbyuvt9kr00doqgdo6plaep1zy0eg7woxx2qb9u____") NIL NIL NIL 0 �� h � ? From: Luxury Watches for Only $250 <vivians@utdk4.com> � Message-ID: <2lvuplhvtq.a5pipaxim3vev5xhjkna58be3xiznpt7qqp47odxw7osxqookmu.siskfbgajfwhah6gvsm8py.cs5wm5s2jqxbk5e@utdk4.com> B @ Subject: ***SPAM*** Elegant Timepieces Starting at $250 a Content-Type: multipart/alternative; boundary="__=--=9041714453803564548693725041=--==" . Date: Sun, 11 May 2025 01:56:45 +1000 N Return-Path: <vivians@utdk4.com> Return-path: <vivians@utdk4.com> , To: info <info@bcmuslimgolfers.com> � A � � p � H � X \ � � H N W [ 7 { D � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 225 8 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 2939 68 NIL NIL NIL NIL) "alternative" ("boundary" "__=--=9041714453803564548693725041=--==") NIL NIL NIL sw h @ / From: McCarthy Green<info@annielg.com> B Message-ID: <20250510115828.7A81C65EBB2C28E0@annielg.com> 3 E Subject: ***SPAM*** Business Requesst... 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 10 May 2025 11:58:28 -0700 + Reply-To: mccarthygreen9@gmail.com L Return-Path: <info@annielg.com> Return-path: <info@annielg.com> % To: info@bcmuslimgolfers.com ( H � � � " 4 U "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 2338 52 NIL NIL NIL NIL � �� h � 9 From: Top Louis Vuitton Bags <melissa@tzkp1.com> Y Message-ID: <zeigsdcujfchpeaobm7q29vxftj.ul0vphm8ppt7a4q-k6tafesi.jeu@tzkp1.com> � > Subject: ***SPAM*** =?windows-1256?B?RGlzY292ZXIgTHV4dXJ5IGZvciA=?= =?windows-1256?B?TGVzcyCWIExvdWlzIFZ1aXR0b24=?= =?windows-1256?B?IEJhZ3MgZnJvbSBKdXN0ICQxNjk=?= =?windows-1256?B?IQ==?= � Content-Type: multipart/alternative; boundary="__==___uj1ktrc4ccxicvpyw6eiuq9332qrz0hvolwioj0wevydqf0ohwwyiim1jkxt3qkd4n2o2f09ziav3n01sfrkx9kg5vxj22k9m12x6____" . Date: Mon, 12 May 2025 15:23:51 +0630 N Return-Path: <melissa@tzkp1.com> Return-path: <melissa@tzkp1.com> , To: info <info@bcmuslimgolfers.com> � A � � � � H 0 _ c � � H � ^ b p � < H 0 � ("text" "plain" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 247 14 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 2476 60 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___uj1ktrc4ccxicvpyw6eiuq9332qrz0hvolwioj0wevydqf0ohwwyiim1jkxt3qkd4n2o2f09ziav3n01sfrkx9kg5vxj22k9m12x6____") NIL NIL NIL 1 V�!h � E From: "BOOM OF SALES" <cnrcigutc@puertocoatzacoalcos.com.mx> Y Message-Id: <202505142349.54ENnJvV019408-54ENnJvX019408@fortimail.apicoatza.com> A J Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS . Date: Wed, 14 May 2025 20:49:20 -0300 t Return-Path: <cnrcigutc@puertocoatzacoalcos.com.mx> Return-path: <cnrcigutc@puertocoatzacoalcos.com.mx> ' To: john.doe@blockstrength.com 0 ( b � � > ) /,%h H ' From: Watches <cora@wse46.com> N Message-ID: <in7yf.nu0ig6iif2fpvbnmjxr5ginnh.dldgkx5c4ji6u@wse46.com> > C Subject: ***SPAM*** Luxury Watches Starting at $250 i Content-Type: multipart/alternative; boundary="====__534831368ukrerfa0roy06lohf1g3upk2pu__====" . Date: Thu, 15 May 2025 19:54:51 +1000 H Return-Path: <cora@wse46.com> Return-path: <cora@wse46.com> , To: info <info@bcmuslimgolfers.com> � A M o � H i _ c 0 : H + ^ b � � 6 ("text" "plain" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 314 10 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 2543 54 NIL NIL NIL NIL) "alternative" ("boundary" "====__534831368ukrerfa0roy06lohf1g3upk2pu__====") NIL NIL NIL x �%h ` 7 : From: Kenneth Pfeffer <kenneth@aiwebtechs.com> Y > Message-ID: <CAHUYY4kfPfGAPi77Vyf3+dj7RrUYY6jSfm1ZhC8+zwkq2eaGXg@mail.gmail.com> 0 ? Subject: S.E.O. for bcmuslimgolfers.com U A Content-Type: multipart/alternative; boundary="000000000000a831740635372c26" . ; Date: Thu, 15 May 2025 19:02:28 -0700 X Return-Path: <kenneth@aiwebtechs.com> Return-path: <kenneth@aiwebtechs.com> 9 9 Sender: Kenneth Pfeffer <kenneth@aiwebtechs.com> , @ To: Info <info@bcmuslimgolfers.com> � A � � � H � + - � � % H � V Y i U � ("text" "plain" ("charset" "UTF-8") NIL NIL "7bit" 1476 37 NIL NIL NIL NIL)("text" "html" ("charset" "UTF-8") NIL NIL "quoted-printable" 6505 85 NIL NIL NIL NIL) "alternative" ("boundary" "000000000000a831740635372c26") NIL NIL NIL 8 �&h � 2 From: Louis Vuitton Deals <zoe@lgfp3.com> � Message-ID: <imtu6i67jhurhgtpklyg4nouz9b3razyrewfnq66fx7bakwyov.dhxaodd6uwbahtejk6agoukwy1uwni-onyuajarpdfq3s1y2ypcfm@lgfp3.com> H C Subject: ***SPAM*** Flash Deal - Louis Vuitton Bags from $200 u Content-Type: multipart/alternative; boundary="__==___uzkn2yn2liiyuhjsyfm4oadshwgesqufwdyskno_-----___==__" . Date: Fri, 16 May 2025 19:58:56 +0630 F Return-Path: <zoe@lgfp3.com> Return-path: <zoe@lgfp3.com> , To: info <info@bcmuslimgolfers.com> � A b � g � H � X \ � H a ^ b � � 6 ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 260 8 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 2558 54 NIL NIL NIL NIL) "alternative" ("boundary" "__==___uzkn2yn2liiyuhjsyfm4oadshwgesqufwdyskno_-----___==__") NIL NIL NIL � �='h � : From: Luxury Watches - Only $250 <nora@abf60.com> � Message-ID: <kmgstnowakqqrdxvklrvtejugxrlcxmfcds.cxrjgvgdinyzivgejbydjtvprscvrzc.uywebpuummaleqfdcgihtcjzalxbitdpipe@abf60.com> H A Subject: ***SPAM*** Unveil Timeless Luxury - Starting at $250 � Content-Type: multipart/alternative; boundary="__==kzrsa3ejpb9egyskgb6iotakondwyxeaiz43xfoaslvnkxaut0kzwfobxdttotmgb==__" . Date: Sun, 18 May 2025 01:32:46 +1000 H Return-Path: <nora@abf60.com> Return-path: <nora@abf60.com> , To: info <info@bcmuslimgolfers.com> � A � ' % � H 1 X \ K ^ H ! W [ B � X ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 1118 19 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 2458 88 NIL NIL NIL NIL) "alternative" ("boundary" "__==kzrsa3ejpb9egyskgb6iotakondwyxeaiz43xfoaslvnkxaut0kzwfobxdttotmgb==__") NIL NIL NIL R�(h ` 8 ) From: Angela Scott <angelascott013@hotmail.com> e - Message-ID: <PU4P216MB18346E8E639FF64AE08DD39F829DA@PU4P216MB1834.KORP216.PROD.OUTLOOK.COM> ( � Subject: ***SPAM*** Re: Cost? w i Content-Type: multipart/alternative; boundary="_000_PU4P216MB18346E8E639FF64AE08DD39F829DAPU4P216MB1834KORP_" . , Date: Sun, 18 May 2025 12:54:03 +0000 ` Return-Path: <angelascott013@hotmail.com> Return-path: <angelascott013@hotmail.com> � A �- �. j � H '. \ _ H �/ [ ^ � 5 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 286 12 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2322 53 NIL NIL NIL NIL) "alternative" ("boundary" "_000_PU4P216MB18346E8E639FF64AE08DD39F829DAPU4P216MB1834KORP_") NIL ("en-IN") NIL Q9 ��)h � / From: Louis Vuitton <stella@eess7.com> o Message-ID: <list-jrparis.netDCMV21H5OEVB.LCG5JZIGHHQUZHCJURAN-XOR6XWN4BI4QVBGSIZTPR6.RGA8C@eess7.com> M G Subject: ***SPAM*** Style Meets Heritage - Louis Vuitton from $200 | Content-Type: multipart/alternative; boundary="__==___lawilqebo9iyy2rzffcth0tewy7tlvd3lfhvs6d0q6ptuiwvx4p____==__" . Date: Mon, 19 May 2025 21:23:51 +0630 L Return-Path: <stella@eess7.com> Return-path: <stella@eess7.com> , To: info <info@bcmuslimgolfers.com> � A < � I � H � L P H N K O � � / � ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 14 1 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "8bit" 3026 47 NIL NIL NIL NIL) "alternative" ("boundary" "__==___lawilqebo9iyy2rzffcth0tewy7tlvd3lfhvs6d0q6ptuiwvx4p____==__") NIL NIL NIL � :F+h 5 From: Top Luxury Watches <delilah@lws12.com> � Message-ID: <p8jza9qi9vmv0rcskgqmehzxmkrnkr813pnr.vemhf7wjnhuaen6lj8mnqmodixqhpzzvn.fugbitwzazx7fvy8r4jic7.drjxdepna2gdtpkbqa.jn8auayzwxcuje891fyxhy@lws12.com> � E Subject: ***SPAM*** =?euc-kr?B?THV4dXJ5IFdhdGNoZXMgZnJvbSA=?= =?utf-8?B?JDI1MCDigJQgU2VlIFdoYXQncyBOZQ==?= =?euc-kr?B?dw==?= p Content-Type: multipart/alternative; boundary="----====____nnu72rt6gcap3ir5gadnjqupsfgh7zxoglib____==" . Date: Wed, 21 May 2025 20:04:29 +1000 N Return-Path: <delilah@lws12.com> Return-path: <delilah@lws12.com> , To: info <info@bcmuslimgolfers.com> � A l � � H � Y ] 4 @ H � X \ � 8 E ("text" "plain" ("charset" "euc-kr") NIL NIL "Quoted-Printable" 320 12 NIL NIL NIL NIL)("text" "html" ("charset" "euc-kr") NIL NIL "Quoted-Printable" 2872 69 NIL NIL NIL NIL) "alternative" ("boundary" "----====____nnu72rt6gcap3ir5gadnjqupsfgh7zxoglib____==") NIL NIL NIL " b�-h x 7 ) From: serni decosta <Sernidecosta@outlook.com> e . Message-ID: <PH7P220MB1278DAB77DA2BD13D578B84BD499A@PH7P220MB1278.NAMP220.PROD.OUTLOOK.COM> F * Subject: Re: Food Delivery/Taxi/KYC Verified Solutions App !! w j Content-Type: multipart/alternative; boundary="_000_PH7P220MB1278DAB77DA2BD13D578B84BD499APH7P220MB1278NAMP_" . - Date: Thu, 22 May 2025 15:59:18 +0000 \ Return-Path: <Sernidecosta@outlook.com> Return-path: <Sernidecosta@outlook.com> � A �* s+ � 2 H + Z ] � � ! H S. Y \ � � W ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 715 33 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 3557 87 NIL NIL NIL NIL) "alternative" ("boundary" "_000_PH7P220MB1278DAB77DA2BD13D578B84BD499APH7P220MB1278NAMP_") NIL ("en-US") NIL }< J/h x . From: L0UlS VUlTTON <sofia@dorz8.com> � Message-ID: <1747982391gwofhmnbriggzgqfxdko.706971830023316.zrjbvboquuljkcorfqorhyqfxijfh.57933472428483755899200610741522@dorz8.com> ? Subject: Grace Meets Glamour - LOUlS VUlTTON from $200 Z Content-Type: multipart/alternative; boundary="__==___36miveq27ki1a6gvg00_=====" . Date: Fri, 23 May 2025 13:09:44 +0630 J Return-Path: <sofia@dorz8.com> Return-path: <sofia@dorz8.com> , To: info <info@bcmuslimgolfers.com> � A � - � H ; _ c � � H � ^ b � y � ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 767 25 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 7033 159 NIL NIL NIL NIL) "alternative" ("boundary" "__==___36miveq27ki1a6gvg00_=====") NIL NIL NIL - d0h � E From: =?utf-8?B?THV44bSccnkgd2F0Y8mmZXM=?= <samas@kbj94.com> s Message-ID: <XOBMT2712SMNVKCTVCIO0BTSWLZVJWEXIKQJCAW7A.VNOL8WNVDKXI4FJGEFLWA.WVN7LAYLXCGJ4MI6ZY@kbj94.com> ? Subject: Experience Sophisticated Timepieces from $250 � Content-Type: multipart/alternative; boundary="____--=5pavuwqzizmyhrhxwlvkowo6nqvffxqpavuju2es0kjfvtxsxweybv7bwlrczkeue=--==" . Date: Tue, 27 May 2025 21:53:45 +1000 J Return-Path: <samas@kbj94.com> Return-path: <samas@kbj94.com> , To: info <info@bcmuslimgolfers.com> � A a � � v H � _ c � � H ^ b � � o 1 ("text" "plain" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 394 9 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 3068 111 NIL NIL NIL NIL) "alternative" ("boundary" "____--=5pavuwqzizmyhrhxwlvkowo6nqvffxqpavuju2es0kjfvtxsxweybv7bwlrczkeue=--==") NIL NIL NIL O �5h � / From: LOUlS VUlTTON <airsa@thev21.com> ] Message-ID: <2xjkuyepljmzieaanaowyjukkekvkkth42crlafieuavdlpc0a2efwszxb5aesgntiyfz0yzkfxapotntysduvmahdqwlycmlpoael7d7yyg2fdsskcnl7hjy-svt.qdiosscu9.mails@k.spokanegroceryboys.com>Message-ID: <qsv8vmzr9qbdtsjq8pery6mnyezbxfbii7zxa0svamstn2s3i2vyw7ytup0fp8c1qaaj8vvfrzu8gwwtcji3l7pom40oryljd8f6h5yqq9riu1ov5kixt7cpx-vac.b7kzusthi@thev21.com> � I Subject: ***SPAM*** =?windows-1250?B?RGlzY292ZXIgTE9VbFMgVlVsVFQ=?= =?utf-8?B?T04gTNW9eNW9cnkgLSBGcm9tICQyMA==?= =?windows-1250?B?MA==?= � Content-Type: multipart/alternative; boundary="__==___11ietp4j1mznym06zhrlcuobev7bxvlx7t0fyidbc7msrc7fvpitobe183iq6kmu6t3nvehdbxdk9fxim0bdib2ujbeoevd30rbvo____==__" . Date: Wed, 28 May 2025 19:57:58 +0630 L Return-Path: <airsa@thev21.com> Return-path: <airsa@thev21.com> , To: info <info@bcmuslimgolfers.com> � A U � w � H � L P H � R V + ] 2 H � � ("text" "plain" ("charset" "utf-8") NIL NIL "8bit" 286 8 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1250") NIL NIL "8bit" 3165 50 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___11ietp4j1mznym06zhrlcuobev7bxvlx7t0fyidbc7msrc7fvpitobe183iq6kmu6t3nvehdbxdk9fxim0bdib2ujbeoevd30rbvo____==__") NIL NIL NIL � �7h t 7 ) From: Rahul Singh <rahulsinghseo4@outlook.com> k . Message-ID: <SEZPR01MB636278FAFE2B95D92A8A52938866A@SEZPR01MB6362.apcprd01.prod.exchangelabs.com> 8 * Subject: Re: Have questions about your website? w l Content-Type: multipart/alternative; boundary="_000_SEZPR01MB636278FAFE2B95D92A8A52938866ASEZPR01MB6362apcp_" . - Date: Thu, 29 May 2025 14:31:55 +0000 ` Return-Path: <rahulsinghseo4@outlook.com> Return-path: <rahulsinghseo4@outlook.com> � A �. D/ �& �' H �. Z ] # Q . H �4 Y \ I � � ! ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 1361 46 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 8422 157 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SEZPR01MB636278FAFE2B95D92A8A52938866ASEZPR01MB6362apcp_") NIL ("en-US") NIL ~U >p8h � 6 From: "SUPER LIST" <info@bcmuslimgolfers.com> I Message-Id: <E1uKvxr-0000000FGZl-1QOp@premium56.web-hosting.com> P A Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 30 May 2025 16:23:47 +0700 \ Return-Path: <info@bcmuslimgolfers.com> Return-path: <info@bcmuslimgolfers.com> % To: info@bcmuslimgolfers.com 0 ( z � 4 ^ * � $y9h h 1 ) From: Eugene 846 <Eugene846@outlook.com> e . Message-ID: <PU4P216MB1534B0C243DD735AC942C7BEFF61A@PU4P216MB1534.KORP216.PROD.OUTLOOK.COM> = * Subject: RE: upgrade, repair, redesign on your site? w i Content-Type: multipart/alternative; boundary="_000_PU4P216MB1534B0C243DD735AC942C7BEFF61APU4P216MB1534KORP_" . - Date: Fri, 30 May 2025 15:13:35 +0000 V Return-Path: <Eugene846@outlook.com> Return-path: <Eugene846@outlook.com> � A �- e. b � H �- Z ] � H �0 Y \ � 1 B ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 526 18 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 2609 66 NIL NIL NIL NIL) "alternative" ("boundary" "_000_PU4P216MB1534B0C243DD735AC942C7BEFF61APU4P216MB1534KORP_") NIL ("en-US") NIL ; ��9h � 6 From: "SUPER LIST" <info@bcmuslimgolfers.com> I Message-Id: <E1uL3S0-00000002KaF-3oKH@premium56.web-hosting.com> P C Subject: ***SPAM*** Email lists 100% VALID - Any country in the world . Date: Fri, 30 May 2025 14:23:25 -0300 \ Return-Path: <info@bcmuslimgolfers.com> Return-path: <info@bcmuslimgolfers.com> % To: info@bcmuslimgolfers.com 0 ( X 4 ^ * H ��9h t 8 ) From: Willa Joseph <Willa1.1Joseph@hotmail.com> f - Message-ID: <JH0PR02MB75091FB643F76DEED16789929562A@JH0PR02MB7509.apcprd02.prod.outlook.com> ? � Subject: ***SPAM*** Re: Boost Your Website Rankings w i Content-Type: multipart/alternative; boundary="_000_JH0PR02MB75091FB643F76DEED16789929562AJH0PR02MB7509apcp_" - , Date: Mon, 2 Jun 2025 13:08:46 +0000 ` Return-Path: <Willa1.1Joseph@hotmail.com> Return-path: <Willa1.1Joseph@hotmail.com> � A . �. @ � H V. Z ] � � H �1 Y \ 0 � V ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 683 18 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 3974 86 NIL NIL NIL NIL) "alternative" ("boundary" "_000_JH0PR02MB75091FB643F76DEED16789929562AJH0PR02MB7509apcp_") NIL ("en-US") NIL VA ��=h T 7 From: LOUlS VUlTTON <lily@oneladyguzellik.com> o Message-ID: <55666157957685494590473688295478.MONEY_ACCOUNT_OBTAINING_MBUS.049109@oneladyguzellik.com> 1 C Subject: ***SPAM*** LOUlS VUlTTON $200 ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1250" - Date: Wed, 4 Jun 2025 01:47:11 +0630 \ Return-Path: <lily@oneladyguzellik.com> Return-path: <lily@oneladyguzellik.com> , To: info <info@bcmuslimgolfers.com> ( H ) m Y � P O "text" "html" ("charset" "windows-1250") NIL NIL "8bit" 2473 80 NIL NIL NIL NIL � uJ?h T 6 ( From: Ashley Hill <ashleyhill004@hotmail.com> f - Message-ID: <SI6PR04MB8342DCFC8B62D1D7E7263650F069A@SI6PR04MB8342.apcprd04.prod.outlook.com> ) Subject: Re: Cost? w i Content-Type: multipart/alternative; boundary="_000_SI6PR04MB8342DCFC8B62D1D7E7263650F069ASI6PR04MB8342apcp_" - , Date: Sat, 7 Jun 2025 11:08:46 +0000 ^ Return-Path: <ashleyhill004@hotmail.com> Return-path: <ashleyhill004@hotmail.com> � A "+ �+ 4 z H b+ \ _ H - [ ^ � � 1 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 267 10 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2025 49 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SI6PR04MB8342DCFC8B62D1D7E7263650F069ASI6PR04MB8342apcp_") NIL ("en-US") NIL V5 Dh L - From: LOUlS VUlTTON <lucy@whoz0.com> g Message-ID: <opaa5lpzwf5uwa9qwvlsnxmhhwb7crakt.ybkugmjprgnxc2uqewl0i0.3df0ixjgubnir@whoz0.com> O E Subject: ***SPAM*** LOUlS VUlTTON Unbelievable Discount - Only $150! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1256" - Date: Sat, 7 Jun 2025 23:41:23 +0630 H Return-Path: <lucy@whoz0.com> Return-path: <lucy@whoz0.com> , To: info <info@bcmuslimgolfers.com> ( H � � ~ � O "text" "html" ("charset" "windows-1256") NIL NIL "8bit" 2457 27 NIL NIL NIL NIL �rDh ` . From: Ro1ex Watches <olivia@ppqp.net> a Message-ID: <uwbkgxnrbuhyzjq.lxuxgutuqteywiqlxxqgfcyuu.mytbxnrmfub.gfwgevlglpf@ppqp.net> d A Subject: ***SPAM*** =?utf-8?B?Um8xZXggV9CwdGPJptC1cyBmcm9tICQ=?= =?windows-1255?B?MjUw?= ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1255" - Date: Mon, 9 Jun 2025 15:47:29 +1000 J Return-Path: <olivia@ppqp.net> Return-path: <olivia@ppqp.net> , To: info <info@bcmuslimgolfers.com> ( H � � � ) O "text" "html" ("charset" "windows-1255") NIL NIL "8bit" 2728 41 NIL NIL NIL NIL �uFh t / ) From: Jeff Haden <jeffhad@outlook.com> f . Message-ID: <SEYPR03MB7698E3E9EF7C509C5308D2E4BE6AA@SEYPR03MB7698.apcprd03.prod.outlook.com> M * Subject: Re: 2nd Follow-up | Accounting, Tax & Bookkeeping Services? w i Content-Type: multipart/alternative; boundary="_000_SEYPR03MB7698E3E9EF7C509C5308D2E4BE6AASEYPR03MB7698apcp_" . - Date: Tue, 10 Jun 2025 12:00:59 +0000 R Return-Path: <jeffhad@outlook.com> Return-path: <jeffhad@outlook.com> � A ') �) r > H g) Z ] F w 1 H H/ Y \ � E � ! ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 1399 49 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 5701 144 NIL NIL NIL NIL) "alternative" ("boundary" "_000_SEYPR03MB7698E3E9EF7C509C5308D2E4BE6AASEYPR03MB7698apcp_") NIL ("en-US") NIL �E � Hh 4 0 From: LOUlS VUlTTON <madison@udna9.com> u Message-ID: <au38lxwxsw5fa3aila4fmalaq9u.6h1uary1kvnvg9f-cimsufz0.eqsw8rbepzy52pvnn6xi3zcka1qdl80@udna9.com> = B Subject: ***SPAM*** LOUlS VUlTTON Starting at $200 � Content-Type: multipart/alternative; boundary="__==___hnnnygmxz2perhlv455t145qo2zczltlzkucjkluf0hf7mg7g2urfrmibnmx3zzaortdgmv____" . Date: Thu, 12 Jun 2025 17:42:28 +0630 N Return-Path: <madison@udna9.com> Return-path: <madison@udna9.com> , To: info <info@bcmuslimgolfers.com> � A � � � a H X \ / 8 H � ^ b � 1 L H � x ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 312 9 NIL NIL NIL NIL)("text" "html" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 3377 76 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___hnnnygmxz2perhlv455t145qo2zczltlzkucjkluf0hf7mg7g2urfrmibnmx3zzaortdgmv____") NIL NIL NIL � X�Jh ( 2 From: "BOOM OF SALES" <cxjmzt@061981.xyz> A O Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Fri, 7 Feb 2025 13:42:54 +0800 N Return-Path: <cxjmzt@061981.xyz> Return-path: <cxjmzt@061981.xyz> + To: inada.marine.service@gmail.com 0 ( e ` � 1 u ��Lh � 0 From: LOUlS VUlTTON <sofia@wkgrand.com> � Message-ID: <1749916036cfivcxnwrxjakbznvpib.321200122903089.luckjmzcjvjqhkdtgglhxuexnsgcy.38115007978457325613617274490354@wkgrand.com> M E Subject: ***SPAM*** Luxury for Less - LOUlS VUlTTON Bags from $200 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1250" . Date: Sat, 14 Jun 2025 22:17:07 +0630 N Return-Path: <sofia@wkgrand.com> Return-path: <sofia@wkgrand.com> , To: info <info@bcmuslimgolfers.com> ( H � � � c [ "text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 2791 99 NIL NIL NIL NIL Y ��Mh � 8 From: Peter Bernstein <info@investmentbank.com> I Message-ID: <20250615014346.947FF698FA611A38@investmentbank.com> p J Subject: ***SPAM*** LOAN / INVESTMENT OFFER ( from US$ 10 Million to US$ 10 Billion for your project) 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 15 Jun 2025 01:43:46 -0700 * Reply-To: pbernstein998@gmail.com Z Return-Path: <info@investmentbank.com> Return-path: <info@investmentbank.com> % To: info@bcmuslimgolfers.com ( H � � A Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2049 65 NIL NIL NIL NIL �Nh d - From: LOUlS VUlTTON <maya@wwab0.com> ~ Message-ID: <wkxeyzfssiefvfdkxygjmyvjotatchzyisqmc.gsoifnbczuneo.lsxnwwywqlefj.fwbjheftptlah.hmhadmaettlyt@wwab0.com> 7 C Subject: ***SPAM*** LOUlS VUlTTON from $200! 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1250" . Date: Wed, 18 Jun 2025 16:43:44 +0630 H Return-Path: <maya@wwab0.com> Return-path: <maya@wwab0.com> , To: info <info@bcmuslimgolfers.com> ( H 5 y * j @ [ "text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 2666 64 NIL NIL NIL NIL _ ��Rh L 1 ) From: Lusia Zeb <lusia80019@hotmail.com> e . Message-ID: <PUWP216MB2624941D0C13F69DCB9F904C9D72A@PUWP216MB2624.KORP216.PROD.OUTLOOK.COM> * Subject: SEO check! w n Content-Type: multipart/alternative; boundary="_000_PUWP216MB2624941D0C13F69DCB9F904C9D72APUWP216MB2624KORP_" . - Date: Wed, 18 Jun 2025 14:59:09 +0000 X Return-Path: <lusia80019@hotmail.com> Return-path: <lusia80019@hotmail.com> � A J- �- R � H �- ^ a � � H �/ ] ` C v 3 ' ("text" "plain" ("charset" "Windows-1252") NIL NIL "quoted-printable" 413 13 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "quoted-printable" 2166 51 NIL NIL NIL NIL) "alternative" ("boundary" "_000_PUWP216MB2624941D0C13F69DCB9F904C9D72APUWP216MB2624KORP_") NIL ("en-GB") NIL �8 ��Rh � . From: Luxury Watches <sara@wse46.com> � Message-ID: <p9h3laj4hvdd-rcdsxfxxlp2nr.jjyote3lfdsl88hvrdgqfqqgxwzp3taxc4wscwpihpk4uiwop5cfqtudeht1z7aisvpodd7hxocupdyblieakmj4xaz.mdqs42teczc@wse46.com>X-Mailer: FOX Mail 3.011 K D Subject: ***SPAM*** Top Luxury Watches for Just $250 - Shop Now! ( Content-Transfer-Encoding: 8bit 8 Content-Type: text/html; charset="iso-2022-jp" . Date: Thu, 19 Jun 2025 04:23:49 +1000 H Return-Path: <sara@wse46.com> Return-path: <sara@wse46.com> , To: info <info@bcmuslimgolfers.com> ( H � � r � [ N "text" "html" ("charset" "iso-2022-jp") NIL NIL "8bit" 2765 91 NIL NIL NIL NIL gSh D - From: Blair E.Ross <Ross@isagro.com> A Message-ID: <20250620122717.841C98ABCCB5758F@isagro.com> ; J Subject: ***SPAM*** WE OFFER LOAN WITH GOOD RATE 4 Content-Transfer-Encoding: quoted-printable 3 Content-Type: text/plain; charset="utf-8" ) Date: 20 Jun 2025 12:27:17 -0700 * Reply-To: blaireross248@gmail.com J Return-Path: <Ross@isagro.com> Return-path: <Ross@isagro.com> % To: info@bcmuslimgolfers.com ( H � � , B T "text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 578 22 NIL NIL NIL NIL � @�Uh T - From: L0UlS VUlTTON <aria@xfho8.com> � Message-Id: <acqvoqskdlwrpohyfafudhreygxqlh.bivys.71836006355097.32827551680461CR0BDKBVOSQKLVKWZ5RDXS0RDBSD02UW@xfho8.com> : B Subject: ***SPAM*** L0UlS VUlTTON for Just $200 ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1250" . Date: Sat, 21 Jun 2025 19:25:45 +0630 H Return-Path: <aria@xfho8.com> Return-path: <aria@xfho8.com> , To: info <info@bcmuslimgolfers.com> ( H � ( b � . O "text" "html" ("charset" "windows-1250") NIL NIL "8bit" 2960 46 NIL NIL NIL NIL G �Vh $ . From: Luxury Watches <arir@lgfp3.com> � Message-ID: <ddcgwmt3pubo0yxythxm5esh07ziyrj4o-jzjiuhegfve8w.xorqnwn6y78fq@lgfp3.com>Precedence: BULK: 2025.02.05-54.240.9.12 ; D Subject: ***SPAM*** Luxury Watches at Just $250! ( Content-Transfer-Encoding: 8bit 7 Content-Type: text/html; charset="WINDOWS-874" H Return-Path: <arir@lgfp3.com> Return-path: <arir@lgfp3.com> , To: info <info@bcmuslimgolfers.com> ( H � 3 7 � V N "text" "html" ("charset" "WINDOWS-874") NIL NIL "8bit" 2701 86 NIL NIL NIL NIL % 6�Wh < $ From: Ro1ex <Tom@svh25.com> m Message-ID: <fokqxfuapyuozpieyos0753860735q0yxve6dokpmnsdltcqf.73858845.607732@svh25.com>55521554256 L C Subject: ***SPAM*** Top Ro1ex: Unbelievable Discount - Only $250! * Content-Transfer-Encoding: base64 3 Content-Type: text/html; charset="gb2312" . Date: Sat, 28 Jun 2025 10:55:05 +1000 F Return-Path: <Tom@svh25.com> Return-path: <Tom@svh25.com> , To: info <info@bcmuslimgolfers.com> ( H 5 y � , K "text" "html" ("charset" "gb2312") NIL NIL "base64" 3328 44 NIL NIL NIL NIL �=_h � - From: Blair E.Ross <Ross@isagro.com> A Message-ID: <20250628031533.E3A3FF45DE87127C@isagro.com> ; C Subject: ***SPAM*** WE OFFER LOAN WITH GOOD RATE ) Date: 28 Jun 2025 03:15:33 -0700 * Reply-To: blaireross248@gmail.com J Return-Path: <Ross@isagro.com> Return-path: <Ross@isagro.com> % To: info@bcmuslimgolfers.com 2 ( H � � �_h d . From: Luxury Watches <salr@qvqx8.com> q Message-ID: <d9r8rnyhgbzt0npqstyasrjazh7.ctykaowe1tnsv03-zw8u3oac.wtw@qvqx8.com>X-Mailer: MIKI Mail 3.01 Y D Subject: ***SPAM*** Top Luxury Watches on Sale for a Limited Time - Only $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1251" . Date: Sun, 29 Jun 2025 03:49:45 +1000 H Return-Path: <salr@qvqx8.com> Return-path: <salr@qvqx8.com> , To: info <info@bcmuslimgolfers.com> ( H x � D 4 O "text" "html" ("charset" "windows-1251") NIL NIL "8bit" 3396 52 NIL NIL NIL NIL � m+`h t 4 From: "SUPER LIST" <nyzkflez@anbobo.online> D Message-Id: <20250409231213.C7751284690@mail.anbobo.online> P F Subject: ***SPAM*** Email lists 100% VALID - Any country in the world - Date: Sun, 6 Apr 2025 03:24:12 +0700 X Return-Path: <nyzkflez@anbobo.online> Return-path: <nyzkflez@anbobo.online> To: jakingman@gmail.com 0 ( s � I * � �bh � - From: L0UlS VUlTT0N <zoes@engb9.com> � Message-ID: <8e1e4gykm6qnvs6kygrorhff6isuh0cyakur6eyhmwsbmztm1f.wyclwchf3lkqlay7fjwpzpepud4hr0-kq5ispoqjqramox9twp4qk@engb9.com>X-Special-Feature: Coupon R F Subject: ***SPAM*** Luxury You Deserve - L0UlS VUlTT0N Starting at $200 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1250" - Date: Tue, 1 Jul 2025 00:12:58 +0630 H Return-Path: <zoes@engb9.com> Return-path: <zoes@engb9.com> , To: info <info@bcmuslimgolfers.com> ( H F � � C F [ "text" "html" ("charset" "windows-1250") NIL NIL "Quoted-Printable" 3139 70 NIL NIL NIL NIL C ��bh � 7 From: Roland Thomas <info@investmentbank.com> I Message-ID: <20250701184540.69B7839304D28E11@investmentbank.com> W J Subject: ***SPAM*** We Offer You Great Opportunity To Complete Your Projects 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 01 Jul 2025 18:45:40 +0200 + Reply-To: rolandtthomass@gmail.com Z Return-Path: <info@investmentbank.com> Return-path: <info@investmentbank.com> % To: info@bcmuslimgolfers.com ( H � 3 � � A Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2047 65 NIL NIL NIL NIL � �dh $ From: kkkk@gmail.com @ Message-ID: <20250702082900.FA2EA6F2BD3872AD@gmail.com> ' Z Subject: ***SPAM*** Business c Content-Type: multipart/alternative; boundary="----=_NextPart_000_0012_0459574B.D451C11E" ) Date: 02 Jul 2025 08:29:00 -0700 ( Reply-To: kwesiboah97@gmail.com H Return-Path: <kkkk@gmail.com> Return-path: <kkkk@gmail.com> % To: info@bcmuslimgolfers.com � A � V � V H ( X \ � 7 H � \ ` � � 0 ("text" "plain" ("charset" "utf-8") NIL NIL "quoted-printable" 2838 55 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 3061 48 NIL NIL NIL NIL) "alternative" ("boundary" "----=_NextPart_000_0012_0459574B.D451C11E") NIL NIL NIL �+ gPeh � / From: Luxury Watches <geros@mdp51.com> � Message-ID: <yjrrmyajwri4os7zdrwkrrssffdtmqmko2ffojegicbf8nahk.1q31oq0bnfrpzbfepymsmtf0vwjt0wg145ryjwajcpzeolvvfdhignmtt50xzilt8kt20q98clokagh1o35q8mhnoza9qycfwltcsoorrfemz4rcnysuyq4ftmkgvvlatlvwrfyq6pwaxywh4y5c5@mdp51.c>Precedence: BULK S D Subject: ***SPAM*** Luxury Timepieces That Define You - Starting at $250 d Content-Type: multipart/alternative; boundary="----==asmf1xznn0d4actwst9usrjwfsbicr==----" - Date: Thu, 3 Jul 2025 02:25:30 +1000 J Return-Path: <geros@mdp51.com> Return-path: <geros@mdp51.com> , To: info <info@bcmuslimgolfers.com> � A C � , � H � [ ^ $ . H K Z ] � � K ("text" "plain" ("charset" "SHIFT_JIS") NIL NIL "Quoted-Printable" 302 10 NIL NIL NIL NIL)("text" "html" ("charset" "SHIFT_JIS") NIL NIL "Quoted-Printable" 3300 75 NIL NIL NIL NIL) "alternative" ("boundary" "----==asmf1xznn0d4actwst9usrjwfsbicr==----") NIL NIL NIL o �]eh | / From: Luxury Watches <karly@7eh3q.com> � Message-ID: <akmuftbpi72bayikr4gmemjeokfzsb7zy4epapqs7d.7303183743028230959349.40181697420.00884971590@7eh3q.com>Precedence: BULK H C Subject: ***SPAM*** Exclusive Luxury Watches Starting at $250 4 Content-Transfer-Encoding: Quoted-Printable 6 Content-Type: text/html; charset="shift_jis" - Date: Thu, 3 Jul 2025 20:43:11 +1000 J Return-Path: <karly@7eh3q.com> Return-path: <karly@7eh3q.com> , To: info <info@bcmuslimgolfers.com> ( H . r � � M X "text" "html" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 3326 77 NIL NIL NIL NIL � �^fh L 1 ) From: Lusia Zeb <lusia80006@hotmail.com> k . Message-ID: <TYZPR01MB5239292DACC72E73252658319343A@TYZPR01MB5239.apcprd01.prod.exchangelabs.com> * Subject: Re: Cost? w m Content-Type: multipart/alternative; boundary="_000_TYZPR01MB5239292DACC72E73252658319343ATYZPR01MB5239apcp_" - - Date: Thu, 3 Jul 2025 15:02:15 +0000 X Return-Path: <lusia80006@hotmail.com> Return-path: <lusia80006@hotmail.com> � A y. #/ 4 z H �. \ _ H W0 [ ^ � � 1 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 267 10 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2025 49 NIL NIL NIL NIL) "alternative" ("boundary" "_000_TYZPR01MB5239292DACC72E73252658319343ATYZPR01MB5239apcp_") NIL ("en-US") NIL �8 Ǜfh H 1 ) From: Lusia Zeb <lusia80068@hotmail.com> f . Message-ID: <TYZPR04MB534804A47AE29689C9426E9A9B43A@TYZPR04MB5348.apcprd04.prod.outlook.com> * Subject: Re: Cost? w n Content-Type: multipart/alternative; boundary="_000_TYZPR04MB534804A47AE29689C9426E9A9B43ATYZPR04MB5348apcp_" - - Date: Thu, 3 Jul 2025 15:25:04 +0000 X Return-Path: <lusia80068@hotmail.com> Return-path: <lusia80068@hotmail.com> � A �. z/ " } H / \ _ H �0 [ ^ � � C # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 273 13 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2790 67 NIL NIL NIL NIL) "alternative" ("boundary" "_000_TYZPR04MB534804A47AE29689C9426E9A9B43ATYZPR04MB5348apcp_") NIL ("en-GB") NIL �; �fh � : From: Leonard Bernstein <info@investmentbank.com> I Message-ID: <20250703151900.07FB28ED29164782@investmentbank.com> p N Subject: ***SPAM*** LOAN / INVESTMENT OFFER ( from US$ 10 Million to US$ 10 Billion for your project) 4 Content-Transfer-Encoding: quoted-printable 7 Content-Type: text/html; charset="iso-8859-1" ) Date: 03 Jul 2025 15:19:00 -0700 0 Reply-To: bernsteinleonard950@gmail.com Z Return-Path: <info@investmentbank.com> Return-path: <info@investmentbank.com> % To: info@bcmuslimgolfers.com ( H � D + N # Y "text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2126 35 NIL NIL NIL NIL gh d 4 From: Luxury Watches <salr@wilsoncreek.net> d Message-ID: <5howh5a5uuvoskx7yberzjgfnbw.mjfde5blmx5ly8f-mwfxk0tf.bpv@qvqx8.com>X-Mailer333 Y F Subject: ***SPAM*** Top Luxury Watches on Sale for a Limited Time - Only $250! ( Content-Transfer-Encoding: 8bit 9 Content-Type: text/html; charset="windows-1251" - Date: Sun, 6 Jul 2025 01:37:30 +1000 T Return-Path: <salr@wilsoncreek.net> Return-path: <salr@wilsoncreek.net> , To: info <info@bcmuslimgolfers.com> ( H , s = 4 O "text" "html" ("charset" "windows-1251") NIL NIL "8bit" 3389 52 NIL NIL NIL NIL 5 �Fih | / From: Luxury Watches <karly@7eh3q.com> � Message-ID: <hovmw496c86sqwzg07mlwtynpffj1dilnfgznf9jeg.6552919043228175300554.16778253174.12362112835@7eh3q.com>Precedence: BULK H G Subject: ***SPAM*** Exclusive Luxury Watches Starting at $250 4 Content-Transfer-Encoding: Quoted-Printable 6 Content-Type: text/html; charset="shift_jis" - Date: Wed, 9 Jul 2025 02:34:51 +1000 J Return-Path: <karly@7eh3q.com> Return-path: <karly@7eh3q.com> , To: info <info@bcmuslimgolfers.com> ( H T � � � M X "text" "html" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 3326 77 NIL NIL NIL NIL �Hmh � - From: L0UlS VUlTT0N <aria@eaz34.com> � Message-ID: <taayfigisicihnktynfkiweaqqjmaerj.okvznerjimvdybenazumrkcsmhgtxhwskuxkogtr.akpgdldjyh.axagrfdvvk@eaz34.com>X-Campaign-ID: bnbjsllsX-Campaign-ID: bnbjslls V D Subject: ***SPAM*** Step Into Iconic Style - L0UlS VUlTT0N Starting at $200 � Content-Type: multipart/alternative; boundary="__==___ntvjdk5gblnudybce0tcseplnifni067jat7vbvmeri51rikouyez0cuzdfvzlde6dwloffuj5bntfzo9dnw5w2ayqjzkzi8vqpov____==__" . Date: Thu, 10 Jul 2025 01:12:21 +0630 H Return-Path: <aria@eaz34.com> Return-path: <aria@eaz34.com> , To: info <info@bcmuslimgolfers.com> � A _ � � H X \ % 1 H � W [ H � F H � ("text" "plain" ("charset" "utf-8") NIL NIL "Quoted-Printable" 305 12 NIL NIL NIL NIL)("text" "html" ("charset" "utf-8") NIL NIL "Quoted-Printable" 3214 70 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__==___ntvjdk5gblnudybce0tcseplnifni067jat7vbvmeri51rikouyez0cuzdfvzlde6dwloffuj5bntfzo9dnw5w2ayqjzkzi8vqpov____==__") NIL NIL NIL N�nh � 1 From: Luxury Watches <vivians@m7k6d.com> � Message-ID: <jx4yajsmhqpxsyxabvggptit6wrhqxjudawhkesub0.wgx84wpmlovbwixmvb0sbfmnxkjjc83cwrfrlsmvexxdft3tlc@m7k6d.com>X-Tracking-ID: 669 6 D Subject: ***SPAM*** Luxury Watches for $250 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1255" . Date: Fri, 11 Jul 2025 21:20:35 +1000 N Return-Path: <vivians@m7k6d.com> Return-path: <vivians@m7k6d.com> , To: info <info@bcmuslimgolfers.com> ( H � T � M [ "text" "html" ("charset" "windows-1255") NIL NIL "Quoted-Printable" 3233 77 NIL NIL NIL NIL � ��ph � 4 From: R0LEX & 0MEGA <karly@obezyaniysad.ru> � Message-ID: <zfcfrlinyuqvvsnj5lcpxoc3rn8sudjjwnmdc6ujzu.8623588987323144558959.73954574468.72020946837@obezyaniysad.ru>Precedence: 11BULK � D Subject: ***SPAM*** =?shift_jis?B?UjBMRVggJiAwTUVHQSBTdGFydHM=?= =?utf-8?B?IGZyb20gSnVzdCAkMjUwIOKAkyBFeA==?= =?shift_jis?B?cGxvcmUgTm93IQ==?= 4 Content-Transfer-Encoding: Quoted-Printable 6 Content-Type: text/html; charset="shift_jis" V Return-Path: <karly@obezyaniysad.ru> Return-path: <karly@obezyaniysad.ru> , To: info <info@bcmuslimgolfers.com> ( H 1 x � I X "text" "html" ("charset" "shift_jis") NIL NIL "Quoted-Printable" 3078 73 NIL NIL NIL NIL � W�sh d , From: 0MEGA&R0LEX <nora@399469.net> � Message-ID: <scmevyzp56.rpqeudapkwas1xgxyhjec5c5bk8nrteqn7wbnidd3mixkwuxhx.i9gfqjsfnr0859kquowdbhtejbso6ptsts5zvjoxnunkkdaf5pr@399469.net>X-Mailer: MapMail 24.021 I E Subject: ***SPAM*** 0MEGA&R0LEX Starting at $250 - Shop Today! * Content-Transfer-Encoding: base64 9 Content-Type: text/html; charset="windows-1253" J Return-Path: <nora@399469.net> Return-path: <nora@399469.net> , To: info <info@bcmuslimgolfers.com> ( H � = � � % Q "text" "html" ("charset" "windows-1253") NIL NIL "base64" 2770 37 NIL NIL NIL NIL � H th p < ) From: Sophia Jensen <SophiaJensen12345@outlook.com> k . Message-ID: <KL1PR01MB52315B7B77F921CA1524E480F854A@KL1PR01MB5231.apcprd01.prod.exchangelabs.com> % * Subject: Re: Reminder Email? w l Content-Type: multipart/alternative; boundary="_000_KL1PR01MB52315B7B77F921CA1524E480F854AKL1PR01MB5231apcp_" . - Date: Mon, 14 Jul 2025 19:37:30 +0000 f Return-Path: <SophiaJensen12345@outlook.com> Return-path: <SophiaJensen12345@outlook.com> � A , �, � B H Z, \ _ � � H �/ [ ^ b � d $ ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 758 30 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 5830 100 NIL NIL NIL NIL) "alternative" ("boundary" "_000_KL1PR01MB52315B7B77F921CA1524E480F854AKL1PR01MB5231apcp_") NIL ("en-GB") NIL �F ]uh , D ) From: =?gb2312?B?V6izIEioom8gLQ==?= <Wuhao4525@outlook.com> k . Message-ID: <KUXPR01MB7844000B41411F3B1C8ACB1EBE57A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> " * Subject: Re: share report w | Content-Type: multipart/alternative; boundary="_000_KUXPR01MB7844000B41411F3B1C8ACB1EBE57AKUXPR01MB7844apcp_" . - Date: Tue, 15 Jul 2025 13:31:55 +0000 l 5 In-Reply-To: <KUXPR01MB7844C4247CD09A668D45A481BE54A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> p 0 References: <TYSPR01MB7181FD26FBEA3D72994D28DABE4BA@TYSPR01MB7181.apcprd01.prod.exchangelabs.com> <TYSPR01MB7181FC8A62800203ADE5FEC5BE4AA@TYSPR01MB7181.apcprd01.prod.exchangelabs.com> <KUXPR01MB78446D6502A2FDF7C2854737BE55A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> <KUXPR01MB7844C4247CD09A668D45A481BE54A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> V Return-Path: <Wuhao4525@outlook.com> Return-path: <Wuhao4525@outlook.com> � A p0 *1 � � H �0 N Q e j H �2 W Z � � % ("text" "plain" ("charset" "gb2312") NIL NIL "base64" 362 5 NIL NIL NIL NIL)("text" "html" ("charset" "gb2312") NIL NIL "quoted-printable" 1772 37 NIL NIL NIL NIL) "alternative" ("boundary" "_000_KUXPR01MB7844000B41411F3B1C8ACB1EBE57AKUXPR01MB7844apcp_") NIL ("en-US") NIL : �Xvh t < ) From: James Anderson <Apps.web.seo3215@outlook.com> f - Message-ID: <KUXPR04MB8851D2CF33FF2D699E058724C257A@KUXPR04MB8851.apcprd04.prod.outlook.com> 5 � Subject: ***SPAM*** Re: Quality with price w i Content-Type: multipart/alternative; boundary="_000_KUXPR04MB8851D2CF33FF2D699E058724C257AKUXPR04MB8851apcp_" . , Date: Tue, 15 Jul 2025 17:54:21 +0000 d Return-Path: <Apps.web.seo3215@outlook.com> Return-path: <Apps.web.seo3215@outlook.com> � A �- ). 2 � H �- Z ] * 8 H �/ Y \ � � > ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 312 14 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 2255 62 NIL NIL NIL NIL) "alternative" ("boundary" "_000_KUXPR04MB8851D2CF33FF2D699E058724C257AKUXPR04MB8851apcp_") NIL ("en-US") NIL �8 /�vh � D ) From: =?gb2312?B?V6izIEioom8gLQ==?= <Wuhao4525@outlook.com> k . Message-ID: <KUXPR01MB78449606EAC65F5E1F3D495BBE56A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> " * Subject: Re: share report w { Content-Type: multipart/alternative; boundary="_000_KUXPR01MB78449606EAC65F5E1F3D495BBE56AKUXPR01MB7844apcp_" . - Date: Wed, 16 Jul 2025 14:00:06 +0000 l 6 In-Reply-To: <KUXPR01MB7844000B41411F3B1C8ACB1EBE57A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> � 0 References: <TYSPR01MB7181FD26FBEA3D72994D28DABE4BA@TYSPR01MB7181.apcprd01.prod.exchangelabs.com> <TYSPR01MB7181FC8A62800203ADE5FEC5BE4AA@TYSPR01MB7181.apcprd01.prod.exchangelabs.com> <KUXPR01MB78446D6502A2FDF7C2854737BE55A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> <KUXPR01MB7844C4247CD09A668D45A481BE54A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> <KUXPR01MB7844000B41411F3B1C8ACB1EBE57A@KUXPR01MB7844.apcprd01.prod.exchangelabs.com> V Return-Path: <Wuhao4525@outlook.com> Return-path: <Wuhao4525@outlook.com> � A / �/ i H D/ N Q � � H �2 W Z � 1 D ("text" "plain" ("charset" "gb2312") NIL NIL "base64" 708 10 NIL NIL NIL NIL)("text" "html" ("charset" "gb2312") NIL NIL "quoted-printable" 3121 68 NIL NIL NIL NIL) "alternative" ("boundary" "_000_KUXPR01MB78449606EAC65F5E1F3D495BBE56AKUXPR01MB7844apcp_") NIL ("en-US") NIL ? ��wh ` 6 ) From: Ashley Hill <ashleyhill039@hotmail.com> k . Message-ID: <KL1PR01MB670181FA173D0256AAC85F6CFE5CA@KL1PR01MB6701.apcprd01.prod.exchangelabs.com> " * Subject: Re: Cost please? w j Content-Type: multipart/alternative; boundary="_000_KL1PR01MB670181FA173D0256AAC85F6CFE5CAKL1PR01MB6701apcp_" . - Date: Tue, 22 Jul 2025 14:11:56 +0000 ^ Return-Path: <ashleyhill039@hotmail.com> Return-path: <ashleyhill039@hotmail.com> � A �+ u, 4 z H , \ _ H �- [ ^ � � 1 # ("text" "plain" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 267 10 NIL NIL NIL NIL)("text" "html" ("charset" "iso-8859-1") NIL NIL "quoted-printable" 2025 49 NIL NIL NIL NIL) "alternative" ("boundary" "_000_KL1PR01MB670181FA173D0256AAC85F6CFE5CAKL1PR01MB6701apcp_") NIL ("en-US") NIL 6 ��h � B From: Luxury Watches at Unbeatable Prices <nora@ppqp.net> � Message-ID: <764943959647172728861396512253166.szc1gpjfheyyh.jewajoaafwnfh.khuvluod2isr.wwqjhleoqlniqjxdynneu.sbgnarqmzep@ppqp.net>ppqp.net E D Subject: ***SPAM*** Luxury Timepieces at Unbeatable Prices 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1256" . Date: Wed, 23 Jul 2025 02:06:29 +1000 F Return-Path: <nora@ppqp.net> Return-path: <nora@ppqp.net> , To: info <info@bcmuslimgolfers.com> ( H � � � � A [ "text" "html" ("charset" "windows-1256") NIL NIL "Quoted-Printable" 2794 65 NIL NIL NIL NIL D ;�h � ; ) From: Samita Rani <onlinemarketing123@hotmail.com> e . Message-ID: <CO1P222MB0193A8C9DAAFABFFD58CFF54945EA@CO1P222MB0193.NAMP222.PROD.OUTLOOK.COM> O * Subject: Re: Let's schedule a quick Zoom / Phone call for Accounting ? w h Content-Type: multipart/alternative; boundary="_000_CO1P222MB0193A8C9DAAFABFFD58CFF54945EACO1P222MB0193NAMP_" . - Date: Thu, 24 Jul 2025 12:14:58 +0000 h Return-Path: <onlinemarketing123@hotmail.com> Return-path: <onlinemarketing123@hotmail.com> � A $+ �+ � 8 H d+ Z ] � $ H �. Y \ / � � ("text" "plain" ("charset" "us-ascii") NIL NIL "quoted-printable" 768 36 NIL NIL NIL NIL)("text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 7094 135 NIL NIL NIL NIL) "alternative" ("boundary" "_000_CO1P222MB0193A8C9DAAFABFFD58CFF54945EACO1P222MB0193NAMP_") NIL ("en-US") NIL �J $�h � @ From: R0LEX & 0MEGA <vivians@asfndbie3btrkjhsgiuwer.ru> � Message-ID: <p46bhpcfx5h4pesylho9n18aqiak7itz9p886annr6.vevgix3zntjgqlfbsgdipnug78ultusxsvtmidmitux7zkkb4z@m7k6fwwwww4d.com>X-Thntrracking-ID: 669 6 D Subject: ***SPAM*** R0LEX & 0MEGA Only $250 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1255" n Return-Path: <vivians@asfndbie3btrkjhsgiuwer.ru> Return-path: <vivians@asfndbie3btrkjhsgiuwer.ru> , To: info <info@bcmuslimgolfers.com> ( H U % k F [ "text" "html" ("charset" "windows-1255") NIL NIL "Quoted-Printable" 3179 70 NIL NIL NIL NIL 5 pÄh P 8 % From: Saif Ahmed <lnfo@alraffahinvestments.com> N ) Message-ID: <20250727162146.59682B5BC29D2C8A@alraffahinvestments.com> : ' Subject: Project-Funding info@bcmuslimgolfers.com 4 , Content-Transfer-Encoding: quoted-printable + Content-Type: text/html ) ( Date: 27 Jul 2025 16:21:46 -0700 / $ Reply-To: info@alraffahinvestments.com P Return-Path: <admin@all4rent.net> Return-path: <admin@all4rent.net> % & To: info@bcmuslimgolfers.com ( H r " V "text" "html" ("charset" "us-ascii") NIL NIL "quoted-printable" 802 18 NIL NIL NIL NIL 0 ��h � @ From: R0LEX & 0MEGA <vivians@asfndbie3btrkjhsgiuwer.ru> � Message-ID: <5ufyubt89q6nzg1gijmzd06pov3qvdv46fd2v0quno.kego9lqmuaqfbtedukune4cmngklmden8ar6lnpm5zl4m94bj7@m7k6fwwwww4d.com>X-Thntrracking-ID: 669 6 D Subject: ***SPAM*** R0LEX & 0MEGA Only $250 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1255" n Return-Path: <vivians@asfndbie3btrkjhsgiuwer.ru> Return-path: <vivians@asfndbie3btrkjhsgiuwer.ru> , To: info <info@bcmuslimgolfers.com> ( H U % k F [ "text" "html" ("charset" "windows-1255") NIL NIL "Quoted-Printable" 3179 70 NIL NIL NIL NIL 5 _��h h : From: R0LEX & 0MEGA <arir@sjkdfhiewbrkjhsdjgf.ru> u Message-ID: <acihejosdzfyzwqnxyiwh.hsznabgwqxipct.orbwm.viwqi.lsqsr.agljj@sjkdfhiewbrkjhsdjgf.ru>X-olk :lubb K D Subject: ***SPAM*** R0LEX & 0MEGA from $250 - Elevate Your Style 4 Content-Transfer-Encoding: Quoted-Printable 9 Content-Type: text/html; charset="windows-1253" b Return-Path: <arir@sjkdfhiewbrkjhsdjgf.ru> Return-path: <arir@sjkdfhiewbrkjhsdjgf.ru> , To: info <info@bcmuslimgolfers.com> ( H � ] J [ "text" "html" ("charset" "windows-1253") NIL NIL "Quoted-Printable" 3165 74 NIL NIL NIL NIL � �1�h � $ From: nvhmwzm@apicoatza.com Y Message-Id: <202508012138.571LcLUm025787-571LcLUo025787@fortimail.apicoatza.com> A M Subject: ***SPAM*** Advertise up to 200 MILLION EMAILS - Date: Fri, 1 Aug 2025 14:38:22 -0700 / Reply-To: contactarinteresse@gmail.com V Return-Path: <nvhmwzm@apicoatza.com> Return-path: <nvhmwzm@apicoatza.com> # To: ninfo@sosaservices.com 0 ( � v � 4 > �3�h � 2 From: Luxury Watches <arin@dlhesheng.com> � Message-Id: <1MZRK6IOY7SJARMZXWW0K61TQINRKZNE.RE7IF.JWMKHBBVHAJZ9QN0.M3XPD2TJFLOG.V7181231936.FGIBCKOW4CEQ7@dlhesheng.com> T [ Subject: ***SPAM*** Special Collection Release Luxury Watches - From $250 � Content-Type: multipart/alternative; boundary="__---=tcrgch9ospsmllhbtzeoupk1pgwzatzpaphzgbvt0o92tydagskfnufihjxblqxfl7gnau3wmgsuunf0bsvemmk0btnhitriwcnygqu3ywk0k=--__" - Date: Wed, 6 Aug 2025 20:11:09 +1000 P Return-Path: <arin@dlhesheng.com> Return-path: <arin@dlhesheng.com> , To: info <info@bcmuslimgolfers.com> � A h � � H � _ c � � H E ^ b ~ � > H �! � ("text" "plain" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 188 7 NIL NIL NIL NIL)("text" "html" ("charset" "Windows-1252") NIL NIL "Quoted-Printable" 2748 62 NIL NIL NIL NIL)("text" "plain" ("charset" "us-ascii") NIL NIL "7bit" 0 0 NIL NIL NIL NIL) "alternative" ("boundary" "__---=tcrgch9ospsmllhbtzeoupk1pgwzatzpaphzgbvt0o92tydagskfnufihjxblqxfl7gnau3wmgsuunf0bsvemmk0btnhitriwcnygqu3ywk0k=--__") NIL NIL NIL �! r*�h
| ver. 1.6 |
Github
|
.
| PHP 8.2.30 | Генерация страницы: 0.01 |
proxy
|
phpinfo
|
Настройка